KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103020508
Entry
103020508         CDS       T03086                                 

Gene name
FAS
Definition
(RefSeq) Fas cell surface death receptor
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01524  Platinum drug resistance
bacu04010  MAPK signaling pathway
bacu04060  Cytokine-cytokine receptor interaction
bacu04115  p53 signaling pathway
bacu04210  Apoptosis
bacu04217  Necroptosis
bacu04650  Natural killer cell mediated cytotoxicity
bacu04668  TNF signaling pathway
bacu04932  Non-alcoholic fatty liver disease
bacu04940  Type I diabetes mellitus
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05142  Chagas disease
bacu05143  African trypanosomiasis
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05162  Measles
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05320  Autoimmune thyroid disease
bacu05330  Allograft rejection
bacu05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103020508 (FAS)
   04668 TNF signaling pathway
    103020508 (FAS)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103020508 (FAS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103020508 (FAS)
   04217 Necroptosis
    103020508 (FAS)
   04115 p53 signaling pathway
    103020508 (FAS)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103020508 (FAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103020508 (FAS)
   05205 Proteoglycans in cancer
    103020508 (FAS)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103020508 (FAS)
   05330 Allograft rejection
    103020508 (FAS)
   05332 Graft-versus-host disease
    103020508 (FAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103020508 (FAS)
   05022 Pathways of neurodegeneration - multiple diseases
    103020508 (FAS)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    103020508 (FAS)
   04932 Non-alcoholic fatty liver disease
    103020508 (FAS)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103020508 (FAS)
   05161 Hepatitis B
    103020508 (FAS)
   05160 Hepatitis C
    103020508 (FAS)
   05164 Influenza A
    103020508 (FAS)
   05162 Measles
    103020508 (FAS)
   05168 Herpes simplex virus 1 infection
    103020508 (FAS)
   05163 Human cytomegalovirus infection
    103020508 (FAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103020508 (FAS)
   05169 Epstein-Barr virus infection
    103020508 (FAS)
   05165 Human papillomavirus infection
    103020508 (FAS)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    103020508 (FAS)
   05143 African trypanosomiasis
    103020508 (FAS)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103020508 (FAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bacu04050]
    103020508 (FAS)
   04090 CD molecules [BR:bacu04090]
    103020508 (FAS)
Cytokine receptors [BR:bacu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   103020508 (FAS)
CD molecules [BR:bacu04090]
 Proteins
  103020508 (FAS)
SSDB
Motif
Pfam: Death TNFR_c6
Other DBs
NCBI-GeneID: 103020508
NCBI-ProteinID: XP_007179209
UniProt: A0A383ZWB1
LinkDB
Position
Un
AA seq 334 aa
MSKIWVLWPLIFTSIAGPLCKGDNAHVADSNSEMLKLSKNITKKESCVEGLHREHKFCCQ
PCPPGKRKNDDCKIDGGEPECVLCAEGEEYTDKHHHSYNCRRCRVCDGEHGLEVEKNCIR
TQNTKCRCKPNFFCNVSLCEHCNPCTTCEHGIIEKCTPTSNTKCREVFQSTGSRSNLHSL
WALLILIPISALIYREVKRRRRNRKNGHQKSIASNTEMMPLNFTDVDLGKHIISIAEQMK
ITEVKEFVRKNGMEETKIDEIKHDNPQDTAEQKVQLLRNWYQSHGKKDAYCTLIKSLRKA
KLHALAEKIQDIVQKDITSEHENANLQNENESLA
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgtccaagatctgggttctctggccactgatatttacctccattgctggaccattgtgt
aaaggtgataatgcccatgtggctgatagcaactctgagatgctgaaactgagtaagaat
attactaaaaaggagagctgcgttgaaggcctgcatcgtgagcacaaattttgttgtcag
ccgtgtcctcctggcaaacggaaaaatgatgattgcaaaatcgatggaggtgaaccagaa
tgtgtgctctgtgcagagggggaggagtacacagacaagcaccatcattcttataactgc
agaagatgtagagtttgtgatggagaacatggcctagaagtggaaaaaaactgtatccgg
acccagaataccaagtgcagatgtaaaccaaactttttttgtaacgtatctctgtgcgaa
cactgtaacccttgtaccacgtgtgaacatggaatcattgagaaatgcacaccaaccagc
aacaccaaatgcagagaagtgttccaatctacaggctccagatctaacttacacagttta
tgggccctcctgatcctcattccaatatctgcactaatatacagggaggtgaaaagacgg
cgcaggaatagaaagaatggtcaccagaaatctatagcctcaaatactgaaatgatgcca
ctgaatttcacagacgttgatttgggaaaacatatcattagtattgctgaacaaatgaaa
ataactgaagttaaagaatttgttcggaagaatggtatggaggaaactaaaatagatgag
atcaagcacgacaatccccaagatacagctgaacagaaggtccagctgctccgtaattgg
tatcaaagtcatgggaagaaagatgcatattgcactttgattaaaagtctcagaaaagcc
aaacttcatgctcttgcagagaaaattcaagatatagtccagaaggacattactagtgaa
catgaaaatgcaaacttgcaaaatgaaaatgaaagcttggcttaa

DBGET integrated database retrieval system