KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103020647Help
Entry
103020647         CDS       T03086                                 

Gene name
AMY2A
Definition
(RefSeq) amylase, alpha 2A (pancreatic)
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00500  Starch and sucrose metabolism
bacu01100  Metabolic pathways
bacu04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:bacu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    103020647 (AMY2A)
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    103020647 (AMY2A)
Enzymes [BR:bacu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     103020647 (AMY2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 103020647
NCBI-ProteinID: XP_007169561
LinkDB All DBs
Position
Un
AA seq 511 aa AA seqDB search
MKFFLLLSAIGFCWAQYAPNTESGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPP
NENAVINNPSRPWWERYQPVSYKLCTRSGNEDEFKDMVTRCNNVGVRIYVDAIINHMCGN
GVAEGTSSTCGSYFNPGTEDFPAVPYSGWDFNGGKCKTGSGDIENYNDASQVRDCRLVGL
LDLALEKDYVRFTIAEYLNRLIDIGVAGFRIDASKHMWPGDMKAILDKLHNLNTRWFPAG
SKPFIYQEVIDLGGEPIKSSEYFGNGRVTEFKYGAKLGTVLRKWNGEKMSYLKNWGEGWG
FMPSDRALVFVDNHDNQRGHGAGGASILTFWDPRLYKMGVGFMLAHPYGFTRVMSSYRWP
RHFENGQDVNDWIGPPNNNGVIKEVTINSDTTCGNDWVCEHQWRQIRNMVVFRNVVDGQP
LTNWWDNGSNQVAFGRGNRGFIVFNNDDWALSSTLQTGLPAGTYCDVISGDKIGNDCTGI
KIYVSGDGNANFSISNSAEDPFIVIHAESKL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctttctattgctttcagccattggattctgctgggctcagtatgccccaaat
accgaatctggacggacatctattgtccatctgtttgagtggcgctgggttgatattgct
cttgaatgtgagcgatacttagctcccaaaggatttggaggggttcaggtttccccaccc
aatgaaaatgcggtaattaataacccttcaagaccttggtgggaaagataccaaccagtt
agctacaagttatgtacaagatcaggaaatgaggatgaattcaaagacatggtgactaga
tgtaacaacgttggtgtccgtatttatgtggatgctataattaatcatatgtgtggaaat
ggtgtggctgaaggaacgagcagtacttgtgggagttacttcaaccctggaactgaggat
tttccagcagtcccatactctggttgggattttaatggtggtaaatgtaaaactggaagt
ggagacattgagaactataatgatgcctctcaggtccgagattgtcgtctggttggtctt
cttgatcttgcactggagaaagattatgtgcgcttcacgattgctgaatatctgaaccgt
ctcattgacattggtgtagcagggttcagaattgatgcttctaagcacatgtggcctgga
gacatgaaggcaattttggataaactgcataatctaaacacaagatggttccctgcagga
agtaaacctttcatttaccaggaggtaattgatctgggtggtgagccaattaaaagcagt
gagtactttggaaatggccgtgtgacagaatttaaatatggtgcaaaactaggcacagtt
ctgcgcaagtggaatggagagaagatgtcttacttaaagaactggggagaaggctggggt
ttcatgccttctgacagagcacttgtctttgttgataaccatgacaatcagcgagggcat
ggagctgggggagcatctattcttacattctgggaccctagactgtacaaaatgggagtt
ggatttatgctcgctcatccctacggatttacacgagtaatgtcaagctaccgttggcca
agacattttgaaaatggacaagatgttaatgattggattgggccaccaaataataatgga
gtcattaaagaagttactattaattcagatactacttgtggcaatgactgggtctgtgaa
catcaatggcgtcaaataaggaacatggttgtgttccgtaatgtagttgatggccaacct
ttaacaaactggtgggataatggtagcaaccaagtagcttttggaagaggaaacagagga
ttcattgtctttaacaatgatgactgggcattatcttcaactttgcaaactggtcttcct
gctggtacatattgtgatgtcatttctggagataaaattggtaacgattgtacaggaatt
aaaatctatgtttccggcgatggcaatgctaatttttctattagtaactctgctgaagat
ccatttattgtgattcatgctgaatctaaattataa

DBGET integrated database retrieval system