KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103020845
Entry
103020845         CDS       T03086                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00230  Purine metabolism
bacu01100  Metabolic pathways
bacu01522  Endocrine resistance
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04022  cGMP-PKG signaling pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04114  Oocyte meiosis
bacu04211  Longevity regulating pathway
bacu04213  Longevity regulating pathway - multiple species
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04270  Vascular smooth muscle contraction
bacu04371  Apelin signaling pathway
bacu04540  Gap junction
bacu04611  Platelet activation
bacu04713  Circadian entrainment
bacu04714  Thermogenesis
bacu04723  Retrograde endocannabinoid signaling
bacu04724  Glutamatergic synapse
bacu04725  Cholinergic synapse
bacu04727  GABAergic synapse
bacu04740  Olfactory transduction
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04911  Insulin secretion
bacu04912  GnRH signaling pathway
bacu04913  Ovarian steroidogenesis
bacu04914  Progesterone-mediated oocyte maturation
bacu04915  Estrogen signaling pathway
bacu04916  Melanogenesis
bacu04918  Thyroid hormone synthesis
bacu04921  Oxytocin signaling pathway
bacu04923  Regulation of lipolysis in adipocytes
bacu04925  Aldosterone synthesis and secretion
bacu04926  Relaxin signaling pathway
bacu04927  Cortisol synthesis and secretion
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04934  Cushing syndrome
bacu04935  Growth hormone synthesis, secretion and action
bacu04962  Vasopressin-regulated water reabsorption
bacu04970  Salivary secretion
bacu04971  Gastric acid secretion
bacu04972  Pancreatic secretion
bacu04976  Bile secretion
bacu05032  Morphine addiction
bacu05163  Human cytomegalovirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05200  Pathways in cancer
bacu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103020845 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103020845 (ADCY3)
   04371 Apelin signaling pathway
    103020845 (ADCY3)
   04020 Calcium signaling pathway
    103020845 (ADCY3)
   04072 Phospholipase D signaling pathway
    103020845 (ADCY3)
   04024 cAMP signaling pathway
    103020845 (ADCY3)
   04022 cGMP-PKG signaling pathway
    103020845 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103020845 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103020845 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103020845 (ADCY3)
   04062 Chemokine signaling pathway
    103020845 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    103020845 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    103020845 (ADCY3)
   04912 GnRH signaling pathway
    103020845 (ADCY3)
   04913 Ovarian steroidogenesis
    103020845 (ADCY3)
   04915 Estrogen signaling pathway
    103020845 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    103020845 (ADCY3)
   04921 Oxytocin signaling pathway
    103020845 (ADCY3)
   04926 Relaxin signaling pathway
    103020845 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    103020845 (ADCY3)
   04918 Thyroid hormone synthesis
    103020845 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    103020845 (ADCY3)
   04916 Melanogenesis
    103020845 (ADCY3)
   04925 Aldosterone synthesis and secretion
    103020845 (ADCY3)
   04927 Cortisol synthesis and secretion
    103020845 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103020845 (ADCY3)
   04270 Vascular smooth muscle contraction
    103020845 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    103020845 (ADCY3)
   04971 Gastric acid secretion
    103020845 (ADCY3)
   04972 Pancreatic secretion
    103020845 (ADCY3)
   04976 Bile secretion
    103020845 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103020845 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    103020845 (ADCY3)
   04727 GABAergic synapse
    103020845 (ADCY3)
   04725 Cholinergic synapse
    103020845 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    103020845 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    103020845 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    103020845 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    103020845 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    103020845 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103020845 (ADCY3)
   04714 Thermogenesis
    103020845 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103020845 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    103020845 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103020845 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103020845 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103020845 (ADCY3)
   05163 Human cytomegalovirus infection
    103020845 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103020845 (ADCY3)
Enzymes [BR:bacu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103020845 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA OPA3 Peptidase_S49_N
Other DBs
NCBI-GeneID: 103020845
NCBI-ProteinID: XP_007191315
UniProt: A0A384AVA4
LinkDB
Position
Un
AA seq 1200 aa
MPRTQGFSDPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLAPLAVAGVGLVLDII
LFALCRKGLLPTRVTRKVVPYVLWLLITAQVFCYLGLNFSRAHAASDTVGWQAFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQRDGLKAMQLLREILANVFLYLCAIVVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCD
YLDEKGIETYLIIASKPEVKRTAAQNGLSGSALPNGAPPSSKPGSPALIETKEPDGSIHT
SGSTSEGPEEPDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKKRNTFLLSMRFMDREMETRYSVEKEKQSGAAFSCSCVVLLCTALVEILIDPWLMTN
YVTFVVGEVLLLLLTVCSLAAIFPRAFPKKIVAFSTWIDRTRWARNTWAMLAIFILVMAN
VVDMLSCLQYYMGPTNGTSGVQIEDGCVENPKYYNYVAVLSLIATIMLVQVSHMVKLTLM
LLIAGAVAVINIYAWRPIFDEYDRRRFQEHDFPMVALEKMQVLSSPGLNGTDRLPLVPSK
CSMTVMIFVMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEH
VARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDF
DSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTSSNKEKSDKERWQHLADLADFA
LAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVM
GNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGREKPATFPNGSSVTLPHQR
GHGRREQECTRGATRLLPSCPAGSTGGAALFTMRAGSCSAPRLELGSSAFHSEDLLASVV
NT seq 3603 nt   +upstreamnt  +downstreamnt
atgccgaggacccagggcttctccgatcctgagtactcggccgagtactcagccgagtac
tccgtcagcctgccctctgaccctgaccgcggggtgggccggacccatgagatctctgtc
cggaactcgggatcctgcctgtgcctgcctcgcttcatgcggctgaccttcgtgccggag
tccttggagaacctgtaccagacctacttcaagaggcagcgccacgagacgctgctcgtg
ctggtggtcttcgcggccctcttcgactgctacgtggtggtcatgtgcgcggtggtcttc
tccagtgacaaactggctccccttgccgtggccggggtcgggctggtgttggacatcatc
ctctttgcgctctgcagaaaggggctgctccccacccgggtcacccggaaagtggtgccc
tacgtgctgtggctgctgataacagcccaggtcttctgctacctgggcctgaacttctcc
cgcgcccatgcagccagcgacacggtgggctggcaggccttctttgtcttctccttcttc
atcacgctgcccctcagcctcagccccatcgtcatcatctctgtggtctcctgcgtcgtg
cacacgctcgtcttgggggtcaccgtggcccagcagcagcgggacgggctgaaggcgatg
cagttgctgagggagattctggccaacgtcttcctctacctgtgcgccatcgtcgtgggc
atcatgtcctactacatggcggaccgcaagcaccgcaaggccttcctggaggcccgccag
tcgctggaggtgaagatgaacctggaggagcagagccagcagcaggagaaccttatgctt
tccatcctgcccaagcacgtggcagatgagatgctgaaggacatgaagaaggacgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccgccacgagaacgtcagcatt
ctctttgccgacatcgtgggcttcacccagctgtcttcagcctgcagcgcccaagagctc
gtgaagctcctcaacgagctctttgcccgcttcgacaagctggcggccaaataccaccag
ctgcggattaagattctgggcgactgttactactgcatctgtgggctgcctgactaccgg
gaggaccacgccgtctgctccatcctcatggggctcgccatggtggaggccatctcgtat
gtacgggagaagacgaagaccggggtggacatgcgagtcggggtgcacacgggcaccgtg
ctggggggtgtcctgggccagaagcgctggcagtacgatgtgtggtccaccgatgtcacc
gtggccaacaagatggaggccggcggcatccccgggcgcgtgcacatctcccagagcacc
atggactgcctgaaaggcgagttcgatgtggagccaggcgacgggggcagccgctgtgat
tacctggatgagaagggcatcgaaacctacctcatcattgcgtccaagccagaggtgaag
aggacagccgcccaaaatggcctcagtggctcagctctgccgaacggagcgccaccttcc
tcgaagcccggctccccagcgctcattgagaccaaggagcccgacgggagcatccacacc
agcggctccacgtccgaggggcccgaggagcccgatgcccaggctgacaacccctcattc
cccaaccctcgccggaggctgcggcttcaggacctggccgatcgcgtggtggacgcctcc
gaggacgagcacgagctcaaccagctgctcaacgaggccctgctggagcgggagtccgcc
caggtagtgaagaagagaaacaccttcctcctgtccatgcggttcatggaccgcgagatg
gaaacccgctactcggtggagaaggagaagcagagcggggccgccttcagctgctcctgc
gtcgtcctgctctgtacggccctggttgagattctcatcgacccctggctgatgacaaac
tacgtgacctttgtggttggcgaggtcctgctcctgctcctgaccgtctgctcactggct
gccatctttcctcgggcctttcctaagaagatcgtggccttctcgacttggatcgaccgg
acgcgctgggccaggaacacctgggccatgcttgccatcttcattctggtcatggcgaat
gtcgtggacatgcttagctgtctccagtactacatgggacccaccaacggcacctcaggg
gtgcagatagaggacggctgcgtggagaaccccaagtattacaactacgtcgctgtgctg
tccctcatcgccaccatcatgctggtgcaggtcagccacatggtcaagctgacactcatg
ctgctcatcgcaggggctgtggccgtcatcaacatctacgcctggcgccccatctttgat
gaatacgaccgcagacgcttccaggaacacgactttccgatggtggccttagagaagatg
caggtactttccagccctgggctcaatggcactgacaggctgcccctggtgccttctaag
tgctccatgacggtgatgatctttgtcatgatgctgagcttttactacttctcccgccac
gtggagaagctggcacggacactgttcttatggaagattgaggtccacgaccagaaggaa
cgtgtctatgaaatgagacgttggaacgaggccttggtcactaacatgttgcctgagcac
gtggcccgccattttctggggtccaagaagagagacgaggagctctacagtcagtcttat
gacgagattggagtcatgtttgcctccctgcccaactttgctgacttctacacagaggag
agcatcaataacggtggcattgagtgtctgcgcttcctcaatgagatcatctcagatttt
gactctctcctggacaatcccaagtttcgggtcatcaccaagatcaaaaccattggcagc
acctacatggcagcttcaggagtcaccccagatgtcaacaccaacggctttaccagctcc
aacaaggagaagtcagacaaggagcgctggcagcacctggcagatctggccgacttcgcg
ctcgccatgaaagacacgctcaccaatatcaacaaccagtccttcaacaacttcatgttg
cgcattggcatgaacaaaggaggggtactggctggcgtcatcggagcccggaagccacac
tacgacatctggggcaatacagtcaacgtagccagcaggatggagtccacaggggtcatg
ggcaacattcaggtggtggaagaaactcaagtcatccttcgagagtatggcttccgcttt
gtgaggagagggcccatctttgtgaaagggaagggggagctgctaaccttcttcttgaag
gggcgagagaagccagccacgttccctaatggctcctcggttacactgccccaccagaga
ggccatggccgccgtgagcaggaatgtaccagaggagcaacaaggctgctgccttcgtgc
ccggcggggagcacaggtggcgcagctctgtttaccatgagggctggcagctgctctgct
ccccggctagaacttggaagcagcgcttttcactctgaagacctgcttgcctctgtggtc
tga

DBGET integrated database retrieval system