KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103020860
Entry
103020860         CDS       T03086                                 

Gene name
NR3C1
Definition
(RefSeq) nuclear receptor subfamily 3 group C member 1
  KO
K05771  glucocorticoid receptor
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103020860 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103020860 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:bacu03310]
    103020860 (NR3C1)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    103020860 (NR3C1)
Nuclear receptors [BR:bacu03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   103020860 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 103020860
NCBI-ProteinID: XP_007194225
UniProt: A0A384B3U4
LinkDB
Position
Un
AA seq 781 aa
MDPKESLSPPSREEIPSSVLGRERGNVMDFYKTLRGGATVKVSASSPSLAAASQADSKQQ
RLLVDFPKGSGSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQMSLSSGETDF
RLLEESIANLNRSTSVPENPKNSASAAASAAPTEKEFPKTHSDVSSEQQNLKGQTGTNGG
NVKLYTTDQSTFDIWRKKLQDLEFSSGSPGKETSESPWSSDLLIDENCLLSPLAGEDDPF
LLEGNSKEDRKPLVLPDTKPKIKDNGDLILSSPNSVPLPQVKTEKEDFIELCTPGVIKQE
KLGPVYCQASFSGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIP
PIPVGSENWNRCQGSGDDNLTSLGTLNFSGRSVFSNGYSSPGMRPDVSSPPSSSSAATGP
PPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPAC
RYRKCLQAGMNLEARKTKKKIKGIQQATTGVSQETSENSANKTIVPATLPQLTPTLVSLL
EVIEPEVIYAGYDSSIPDTTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLL
QYSWMFLMSFALGWRSYRQSSSNLLCFAPDLIINEQRMALPCMYDQCKHMLYVSSELNRL
QVSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFY
QLTKLLDSMHDVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSSGNIKKLLFHQ
K
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggaccccaaggaatcattaagcccccccagtagagaagaaatccccagcagtgtgctt
ggtcgagagaggggaaatgtgatggacttctataaaaccctaaggggaggagctactgtg
aaggtttctgcatcttcaccctcactggctgctgcttctcaggcagactccaagcagcaa
agacttttggttgattttccaaaaggctcaggaagcaatgcgcagcagccagatctgtcc
aaggcagtttcactctcaatgggactgtatatgggagagacagagacaaaagtgatggga
aatgacctgggattcccacagcagggccaaatgagcctttcctctggggaaacagacttt
cggcttctggaagaaagcatcgcaaacctcaataggtcgaccagtgttccagagaacccc
aagaattcagcatcagctgctgcctcggctgcccccacagagaaggagtttccaaaaact
cactctgatgtatcttcagaacagcaaaatttgaagggccagactggcactaatgggggt
aatgtgaagttgtataccacagaccaaagcacctttgacatatggaggaaaaaactccag
gatttggagttttcttctgggtccccaggtaaagagacaagtgagagtccttggagctca
gacctcttgatagatgaaaactgtttgctttctcctttggcaggagaggacgatccattc
cttctggaaggaaactcgaaagaggaccgtaagcctcttgttttaccggacactaaacct
aaaattaaggataatggagatcttatcttatcaagccctaacagtgtgccactgccccaa
gtgaaaacagaaaaagaagattttatcgaactctgcacccctggagtaattaagcaggag
aaactgggcccagtttattgtcaggccagcttttctggagcaaatataattggtaataaa
atgtctgccatttctgttcatggtgtgagtacctctgggggacagatgtaccactatgac
atgaatacagcatccctttctcaacagcaggatcagaaacctatttttaatgtcattcca
ccaattcctgttggttcagaaaattggaatagatgccaaggatctggagatgataacttg
acttccttagggactttgaacttctccggtcgatcggttttttctaatggctattcaagc
cctggaatgagaccagatgtaagctctcctccatccagctcctcagcagcaacgggacca
cctcccaaactctgcctagtgtgctctgatgaagcttcgggatgtcattatggggtctta
acttgtggaagctgtaaagtattcttcaaaagagcagtggaaggacagcacaattatctt
tgtgctggaagaaatgattgcatcattgataaaattcgaagaaaaaactgcccagcatgc
cgctatagaaaatgtcttcaagcaggaatgaacctggaagctcgaaaaacaaagaaaaag
ataaaaggaattcagcaggccactacaggagtctcacaagaaacttctgaaaattctgct
aacaaaacaatagtccctgcaacgttaccgcaactcacccctaccctggtgtcactgctg
gaggtcattgagccggaggtgatatatgcgggttacgacagctccattccagatacaact
tggcggatcatgaccacactcaacatgttaggtgggcggcaggtgatcgcagcggtgaaa
tgggcgaaggcgataccaggattcaggaacttacatctggatgaccaaatgaccctactg
caatattcatggatgttcctcatgtcattcgccctggggtggagatcatatagacaatca
agttcaaacttgctgtgttttgctcctgatctgattattaatgagcagagaatggcttta
ccctgcatgtatgaccaatgtaaacatatgctatatgtttcctctgagttaaacagactt
caggtatcttatgaagagtatctctgtatgaaaaccttactgcttctctcttcagttcct
aaggaaggtttgaagagtcaagagctatttgatgaaattagaatgacctacatcaaagag
ctaggaaaagccatcgtcaagagagaaggaaactccagtcagaactggcagcggttttac
cagctgacaaaactcttggactccatgcatgatgtggttgaaaatctccttaactattgc
ttccaaacatttttggataagaccatgagtattgaattcccagagatgttagctgaaatc
atcaccaatcagataccaaaatattcaagtggaaatatcaaaaaacttctgtttcatcaa
aagtga

DBGET integrated database retrieval system