KEGG   Bacillus sp. WP8: QR42_00430Help
Entry
QR42_00430        CDS       T03530                                 

Definition
(GenBank) heat shock protein Hsp33
  KO
K04083  molecular chaperone Hsp33
Organism
bacw  Bacillus sp. WP8
Brite
KEGG Orthology (KO) [BR:bacw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bacw03110]
    QR42_00430
Chaperones and folding catalysts [BR:bacw03110]
 Heat shock proteins
  HSP33
   QR42_00430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: AIZ58847
UniProt: A0A0B4S3X1
LinkDB All DBs
Position
82444..83319
Genome map
AA seq 291 aa AA seqDB search
MDYLVKALAYDGKVRAYAANTTDTINEAQRRHHTWPTASAAIGRTMTATVMMGAMLKGEN
KLTVKIEGGGPIGAIIADGNAKGQVRGYVSNPQVHFDLNEHGKLDVRRAVGTSGTLSVVK
DIGLKDHFTGQTEIVSGEIGDDFTYYLVSSEQVPSSVGVGVLVNPDNSILAAGGFIIQLL
PGTEDAVIERLEKRLSTIEPISKLIEKGMTPEEILEEVLGEKPQILETVPVEFSCNCSKE
RFANGIISLGKAEIDDMIEQDGQAEAQCHFCNETYVFTKEELEELREELTR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggattacttagttaaagcattagcatatgacggaaaagtccgcgcatatgctgcaaac
acaacagatacaatcaacgaagcacaaagaagacatcatacgtggccgactgcatcagct
gccatcggcagaacgatgacagcaaccgtcatgatgggtgctatgctgaaaggtgagaat
aagctaactgtcaaaatagaaggcggtggaccaatcggcgccattattgctgatggaaat
gcaaaaggtcaggtgcgaggatatgtctcaaacccacaagttcactttgatttaaatgaa
catggcaagctggatgttagacgtgcagtcggaacatctggaaccttaagtgttgtcaaa
gatatcgggctgaaggaccactttacaggacaaacggaaattgtttcaggtgaaattgga
gatgacttcacatattatcttgtttcttctgagcaagtgccttcctctgtaggcgtaggc
gtccttgtcaatccagataattcgatcctcgcagcaggcggtttcatcattcaattgctg
cctggtacagaagatgctgtcattgaaagactagaaaagcgtctgtcaacgattgaacca
atctctaaactcattgaaaaagggatgacaccagaagaaatattagaagaagtactcggt
gaaaagcctcaaattttagaaactgtacctgtcgaattctcttgtaactgctcaaaagaa
cggtttgcaaatggcattatcagcctagggaaagccgaaattgatgatatgattgaacaa
gacggacaagcagaagctcaatgccatttttgtaacgaaacgtatgtatttacaaaagaa
gagctagaagagctacgtgaagaattaacccgctaa

DBGET integrated database retrieval system