KEGG   Bacillus sp. WP8: QR42_02030Help
Entry
QR42_02030        CDS       T03530                                 

Definition
(GenBank) cysteine ABC transporter permease
  KO
K10009  L-cystine transport system permease protein
Organism
bacw  Bacillus sp. WP8
Pathway
bacw02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bacw00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    QR42_02030
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bacw02000]
    QR42_02030
Transporters [BR:bacw02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Cystine transporter
    QR42_02030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 GPR_Gpa2_C
Motif
Other DBs
NCBI-ProteinID: AIZ59118
UniProt: A0A0B4S4P6
LinkDB All DBs
Position
complement(426529..427221)
Genome map
AA seq 230 aa AA seqDB search
MLQNNILGVVIPWDLLQQSFWPMVMQGIYYTIPLAIIAFIIGIFIALVTALARMSKIKAL
RWIFSIYVSAVRGTPLFVQLFIIFYFFPTFNITLDPYPSAIIAFSLNVGAYASEIIRASV
LSVPKGQWEAGYSIGMTHRKTLVRVILPQAVRVSIPPLSNSFISLVKDTSLASQILVAEM
FRKSQEIAAANLDQILFIYMEAALIYWVFCFILSLVQHQIEKRLDRYVAR
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgttacaaaataacatcctaggagtcgtcattccttgggatcttcttcagcaatctttt
tggccaatggtgatgcaggggatttattatacaattcccctcgccatcattgcctttatt
attggtatttttatcgcgcttgtgacagctcttgcgagaatgtctaaaattaaagccctc
agatggattttctccatctatgtgtcggccgttcgcggaacgccgctttttgtgcaattg
tttattattttctatttctttccgacatttaatatcacactggatccatatccaagtgcc
attattgctttttctttaaacgtaggtgcgtatgcgtcggaaattatccgtgcatccgtc
ctgtctgttccaaaaggacaatgggaagcaggttattccattgggatgacacatcgcaaa
acgctcgtccgcgtgattttaccgcaggctgtgcgtgtatcaattccaccgctgtctaat
tcattcattagcttggtgaaggatacatcccttgcctcccaaattctcgtggcagagatg
ttccgtaaatcacaggaaattgctgcggcgaacttggatcagatcttgtttatttatatg
gaagcagccctcatctattgggtattctgctttattctatcgctcgttcagcatcaaatt
gaaaaacgacttgatcgatatgtcgcaaggtaa

DBGET integrated database retrieval system