KEGG   Bacillus sp. WP8: QR42_02605Help
Entry
QR42_02605        CDS       T03530                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bacw  Bacillus sp. WP8
Pathway
bacw00473  D-Alanine metabolism
bacw01100  Metabolic pathways
bacw01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bacw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    QR42_02605
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    QR42_02605
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bacw01011]
    QR42_02605
Enzymes [BR:bacw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     QR42_02605
Peptidoglycan biosynthesis and degradation proteins [BR:bacw01011]
 Precursor biosynthesis
  Racemase
   QR42_02605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C BTB_2
Motif
Other DBs
NCBI-ProteinID: AIZ59224
UniProt: A0A0B4S5M9
LinkDB All DBs
Position
552872..554053
Genome map
AA seq 393 aa AA seqDB search
MDTNAFYRDTWAEINLTAIKHNVSHMKDHIGQNVQLMAVVKANAYGHGDIEVARAALKAG
ADLLAVAFLDEAISLRNKGIKAPILILGAVPPEYVKTAVRYNVIMTAYSTRWLREVVDMV
KGQMGQPIRFHLKIDSGMNRLGVKTLEQVNEVKKLVSEHSYLQLEGVFTHFATADEKDEN
YFDRQVDTFQTLLQPLHTEKLLVHCANSAAGLRFKEVLFNMVRFGISMYGLSPSEEIKDE
LPFKLEEAMSLHTKLAHVKLIQKGESVSYGATYTANQDMWIGTVPVGYADGWIRKLAGTE
VLVGGKRRKIAGRVCMDQFMVELKGNLPVGEPVVLIGGQGEEMVSVDEIAKRLETINYEV
TCSIGHRVPRVYIEDGKRVHVRNPLLQGGPSFF
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggacacaaatgccttttatagagacacatgggcagaaattaatttaacagcaatcaag
cacaatgtttcacatatgaaagatcatatcggtcaaaatgttcaactgatggctgttgtg
aaagccaatgcatatggacatggagatatagaagtggcaagagctgccctcaaagcagga
gcagacttgttagctgtagcctttttagatgaggccatttctttaagaaataaaggtatc
aaagcaccgattcttatactcggcgcagtaccgccggagtatgtcaaaaccgctgttcga
tacaatgtaattatgaccgcttactccaccaggtggctgagggaagtcgtcgatatggtg
aaagggcagatgggacaacccattcgttttcatttgaaaatagacagcggaatgaaccgt
ttaggtgtgaaaacgttagagcaagtgaatgaagtaaagaagcttgtcagcgagcattct
tatttacagctggaaggagtatttactcactttgcgaccgcggatgaaaaggatgagaac
tattttgatcggcaggtcgacacctttcaaaccctgcttcagccgcttcatacggaaaaa
ctgcttgttcattgtgccaatagtgcagcaggattaaggtttaaagaagtgttatttaat
atggttcgcttcggcatcagtatgtacgggctgtcaccgtcagaggaaatcaaagatgaa
cttcctttcaagctggaagaagccatgtcgcttcatacaaagcttgcccatgtaaagctc
attcaaaagggtgagagtgtcagctatggggcgacgtatacagctaatcaagatatgtgg
atcggtacggtaccagtcggctatgcagacgggtggattcggaagctggcaggcacggaa
gtacttgttggcggaaagcgccggaagattgcaggaagggtatgtatggatcaattcatg
gttgaactgaaagggaaccttccagtaggggagccagtcgttttgattggtggacaaggt
gaagaaatggtatcagtcgatgaaattgcaaaaaggcttgaaaccattaactatgaagtc
acatgctccattggacaccgcgtcccaagagtatatatagaggacggcaaaagggtgcat
gtgcggaatccgctgcttcaaggcgggccaagctttttctaa

DBGET integrated database retrieval system