KEGG   Bacillus sp. WP8: QR42_03390Help
Entry
QR42_03390        CDS       T03530                                 

Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
bacw  Bacillus sp. WP8
Pathway
bacw00970  Aminoacyl-tRNA biosynthesis
bacw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bacw00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    QR42_03390
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bacw03029]
    QR42_03390
Enzymes [BR:bacw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     QR42_03390
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     QR42_03390
Mitochondrial biogenesis [BR:bacw03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    QR42_03390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AIZ59358
UniProt: A0A0B4S5A2
LinkDB All DBs
Position
697641..699071
Genome map
AA seq 476 aa AA seqDB search
MNFETVIGLEVHVELKTQSKIFSSSPTPFGAAANTQTSVIDLGYPGVLPVLNKEAVNFAM
KAAMALNCEIATDTKFDRKNYFYPDNPKAYQISQFDKPIGENGWIEIEVEGKTKRIGITR
LHLEEDAGKLTHTGDGYSLVDFNRQGTPLVEIVSEPDIRTPEEAYAYLEKLKSIIQYTGV
SDCKMEEGSLRCDANISLRPIGREEFGTKTELKNLNSFAFVQKGLEFEEKRQEQVLLSGG
LIEQETRRYDEASKKTILMRVKEGSDDYRYFPEPDLVELYIDDEWKERVRASIPELPDER
RKRYIDELGLPAYDAMVLTLTKEMSDFFEATISEGAEAKQASNWLMGEVSAYLNSAQKEL
DDTKLTPQGLAGMIKLIEKGTISSKIAKKVFKELIENGGDAETIVKEKGLVQISDEGALL
KLVTEALDNNPQSIEDFKNGKDRAIGFLVGQIMKASKGQANPPMVNKILLEEIKKR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaactttgaaacggtaattggacttgaagtccacgtagagctaaaaacacaatcgaaa
attttctcaagctcgccgacaccttttggtgcagctgccaacacgcaaacaagtgtcatc
gaccttggatatcctggcgtactgcctgtactgaacaaagaagcggtgaactttgcgatg
aaagcggctatggcgctgaactgtgaaatcgcaacggatacaaaatttgaccgtaaaaac
tacttctatcctgataacccaaaggcgtatcaaatttctcaatttgataaaccgatcggt
gaaaacggctggattgaaattgaagtagaaggcaaaacaaaacgaatcggtattacgcgt
ctccatttggaagaggatgcagggaaactaacgcacacaggcgacggttactcactcgtc
gatttcaaccgtcaaggaacaccacttgttgaaatcgtatctgagccagacattcgcacg
ccagaagaagcgtatgcttacttagaaaaattaaaatccattattcaatatacaggcgtt
tctgactgtaagatggaagaaggctcacttcgctgtgatgccaacatttctcttcgccca
atcggccgtgaagagtttggtacaaagacagagctcaaaaacttgaactcatttgctttc
gtacaaaaaggtcttgaattcgaagagaagcgtcaagagcaagtattgctttctggcggc
ttgatcgagcaggaaacacgccgttatgacgaagcgtctaaaaagacaattcttatgcgc
gttaaagaaggctctgatgattaccgttacttcccagaaccggatttggtggagctgtac
attgatgatgagtggaaagaacgcgtaagagcatccatcccagagcttccagacgagcgc
cgcaaacgctacatcgatgagcttggccttcctgcatacgatgcaatggtactcacgctg
acgaaagaaatgtctgatttctttgaagcgaccatttcagaaggtgcagaggcgaagcaa
gcatcgaactggctcatgggtgaagtatctgcttacttaaactctgctcaaaaagagctg
gacgatacaaagctaacgccgcaagggctggctggtatgatcaagcttattgaaaaagga
acgatttcctctaagattgcgaaaaaggtattcaaagagctcatcgaaaatgggggagat
gcagaaacaatcgtcaaagaaaaaggacttgtccaaatttctgacgaaggtgcactgctc
aaacttgtcacagaagcacttgataacaacccgcaatccattgaagactttaaaaatggt
aaagaccgcgcgattggtttcttagtcggacaaatcatgaaagcatcgaagggccaagcg
aacccaccgatggtgaacaagattctccttgaagaaatcaaaaaacgctaa

DBGET integrated database retrieval system