KEGG   Bacillus sp. WP8: QR42_11925Help
Entry
QR42_11925        CDS       T03530                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bacw  Bacillus sp. WP8
Pathway
bacw00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bacw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    QR42_11925
Enzymes [BR:bacw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     QR42_11925
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     QR42_11925
    1.1.1.-  
     QR42_11925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N 2-Hacid_dh_C Sacchrp_dh_NADP F420_oxidored ADH_N_assoc ApbA
Motif
Other DBs
NCBI-ProteinID: AIZ60943
UniProt: A0A0B4S9X0
LinkDB All DBs
Position
complement(2363030..2364070)
Genome map
AA seq 346 aa AA seqDB search
MKALRWHDQKDIRLEEIDEPTVAPGKVKLKVKWCGICGSDLHEYLGGPIFIPVNEPHPLT
KEKAPITLGHEFSGEVVEVGEGVSNYKVGDRVVVEPIFATHGHQGAYNLDENMGFLGLAG
GGGGFSEYVSVDEELLHLLPDEISYEQGALVEPSAVALYAVRSSKVQAGDTAAVFGCGPI
GLLVIEALKAAGATDIYAVELSKERQEKAKELGAIIVDPSQYEDVVQEIARRTNGGVDVS
FEVTGVPVVLKQAIQSTRISGETVIVSIWEKGAEIMPNDIVIKERTVKGIIGYRDVFPSV
LNLMRKGYFSADTLVTKKIKLDDVIEDGFHALINEKDQVKILVSAE
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcactacgctggcacgatcaaaaggacattcgactagaggaaattgacgaacca
acagttgctccaggtaaagtgaaactgaaagtaaaatggtgcggcatttgtggtagtgat
ttacatgaatatttaggcggaccgatcttcattcctgtgaatgaacctcatccacttaca
aaagaaaaagcaccaattacattgggacacgagttctctggggaagttgttgaagtagga
gaaggcgtgagcaattacaaagtaggcgatcgagtggttgttgaacctatttttgcaact
cacgggcatcaaggtgcttataacttagatgaaaacatgggctttttaggacttgccgga
ggcggcggtggattctctgaatatgtatcagttgatgaagaattacttcatttattacca
gacgaaatctcctatgagcaaggcgcgcttgttgagccttctgcagttgctttatatgcg
gtacgttctagtaaagtacaagctggggatacagcggctgtgtttggctgcggaccaatt
ggtttacttgtcattgaagcattaaaagcagctggtgctactgatatttatgcagttgaa
ctatcaaaagaacgccaagagaaagcaaaagagcttggagcgatcattgtagatccttct
caatatgaagatgttgttcaagaaatcgcacgccgtacaaacggtggcgtcgatgtttct
tttgaagtgacaggtgtacctgttgtattgaagcaagcaatccaatcaactagaatttca
ggcgaaaccgtcattgtaagtatttgggaaaaaggcgcagaaattatgccaaatgatatt
gtcatcaaagaacgtacagtgaaaggaattatcggctacagagacgtattcccatctgta
ttaaacttaatgagaaaaggctatttctctgcagacacactcgtcacgaaaaaaatcaag
ctggacgatgtgatcgaggatggcttccatgctttaatcaatgaaaaagatcaagtgaaa
attttagtcagtgctgaataa

DBGET integrated database retrieval system