KEGG   Bacillus sp. WP8: QR42_12890Help
Entry
QR42_12890        CDS       T03530                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bacw  Bacillus sp. WP8
Pathway
bacw00020  Citrate cycle (TCA cycle)
bacw00480  Glutathione metabolism
bacw01100  Metabolic pathways
bacw01110  Biosynthesis of secondary metabolites
bacw01120  Microbial metabolism in diverse environments
bacw01130  Biosynthesis of antibiotics
bacw01200  Carbon metabolism
bacw01210  2-Oxocarboxylic acid metabolism
bacw01230  Biosynthesis of amino acids
Module
bacw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bacw_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bacw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    QR42_12890
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    QR42_12890
Enzymes [BR:bacw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     QR42_12890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AIZ61120
UniProt: A0A0B4SA96
LinkDB All DBs
Position
complement(2564400..2565671)
Genome map
AA seq 423 aa AA seqDB search
MSQGEKITVTGGVLNVPNNPIIPFIEGDGIGPDIWKAASRVLEAAVEKAYKGEKQITWKE
VYAGEKAYNKTGEWLPEQTLEDIREYLIAIKGPLTTPIGGGIRSLNVALRQELDLFTCLR
PVRWFKGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGSDEVKKLIDFLKNELGVNKIR
FPETSGIGIKPVSEEGTSRLVRAAIQYAIDQGRKSVTLVHKGNIMKFTEGAFKNWGYEVA
EKEFGDKVFTWAQYDRIVEQDGKDAANKAQSEAEAAGKIIVKDSIADIFLQQILTRPAEF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVLLSGVLLLEHLGWQEAADLVIQSVEKTIASKVVTYDFARLMDGATEVKCSEFADELIK
NLS
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
ttgtcacaaggcgaaaaaattacagttactggcggcgtattgaatgtaccaaataatcca
atcatcccgtttatcgaaggggacggaatcggtcctgacatttggaaagcggcatcaaga
gtacttgaagcagctgtagaaaaagcatataaaggtgaaaagcaaatcacttggaaagaa
gtatatgcaggtgagaaagcttacaataaaactggagagtggcttcctgagcaaacgctt
gaagacattcgtgaatacttaattgcgattaaaggaccactaacaacaccaattggcgga
ggaatccgttcattaaacgtggcacttagacaagagcttgatttattcacatgcttacgt
ccagttcgctggttcaaaggcgtaccttctcctgttaaacgtccagaagacacagacatg
gtgatcttccgtgagaacacagaagatatctatgctggtattgagtatgcaaaaggttca
gacgaagtgaagaagttaattgacttcttgaaaaacgaattaggtgtgaacaaaatccgt
ttcccagaaacgtcaggtatcggaatcaagccagtttctgaagagggaacatcccgtctt
gtcagagcggctatccaatatgcaattgaccaaggccgtaaatctgtgacgcttgttcac
aaaggaaacatcatgaaatttacagaaggtgccttcaaaaactggggctacgaagtggct
gaaaaagagtttggcgacaaagtctttacatgggcacaatatgatcgtattgtagaacaa
gatggaaaagatgcggcaaacaaagcgcaaagtgaagcagaagctgctggcaaaatcatt
gtcaaagacagcattgcagatattttccttcaacaaatcctaactcgtccagctgagttc
gatgttgtggctacaatgaacttaaatggagattacatctctgatgcacttgcagcacaa
gttggtggaattggtatcgcaccaggagcgaacatcaactacgaaacaggacacgctatt
tttgaagcgactcacggaacagcaccaaaatatgctggtcttgataaagtgaatccatct
tctgttcttctatcaggcgtgctgttacttgagcaccttggctggcaggaagcagctgat
ctagtgattcaatctgttgaaaaaacaattgcatctaaagtcgtcacttacgattttgct
agattaatggatggcgcaacagaagtaaaatgttctgagtttgctgacgagctcatcaaa
aacttgtcttga

DBGET integrated database retrieval system