KEGG   Bacillus sp. WP8: QR42_12920Help
Entry
QR42_12920        CDS       T03530                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bacw  Bacillus sp. WP8
Pathway
bacw00010  Glycolysis / Gluconeogenesis
bacw00030  Pentose phosphate pathway
bacw00051  Fructose and mannose metabolism
bacw00052  Galactose metabolism
bacw00680  Methane metabolism
bacw01100  Metabolic pathways
bacw01110  Biosynthesis of secondary metabolites
bacw01120  Microbial metabolism in diverse environments
bacw01130  Biosynthesis of antibiotics
bacw01200  Carbon metabolism
bacw01230  Biosynthesis of amino acids
bacw03018  RNA degradation
Module
bacw_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bacw_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bacw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    QR42_12920
   00030 Pentose phosphate pathway
    QR42_12920
   00051 Fructose and mannose metabolism
    QR42_12920
   00052 Galactose metabolism
    QR42_12920
  09102 Energy metabolism
   00680 Methane metabolism
    QR42_12920
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    QR42_12920
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:bacw01009]
    QR42_12920
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:bacw03019]
    QR42_12920
Enzymes [BR:bacw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     QR42_12920
Protein phosphatases and associated proteins [BR:bacw01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     QR42_12920
Messenger RNA biogenesis [BR:bacw03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     QR42_12920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: AIZ62287
UniProt: A0A0B4SDI1
LinkDB All DBs
Position
complement(2571305..2572264)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHNVEVYGIYNGYSGLINGKIEKLEIGSVGDI
IHRGGTKLYTARCPEFKTVEGREKGIENLKKFGIEGLVVIGGDGSFMGAKKLTELGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVVEVMGRHAGDIALWS
GLAGGAESILIPEADYDMDEIIARLRRGHERGKKHSIIIVAEGVGSGVEFGKRIEEETSL
ETRVSVLGHIQRGGSPSAFDRVLASRLGAYAVELLLEGQGGRCVGIQSNELVHHDILEIL
DKKHTVDKNMYRLSQELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtataggagttttaacaagcggtggggattccccaggaatgaatgcagctgtg
cgcgcagttgtaaggaaagcaatttaccataatgttgaagtttacggtatttataatgga
tactcaggtctaattaacggtaaaattgagaaactcgaaataggttcggtaggcgatatc
attcatcgtggaggaacaaaactttacacggcaagatgtcctgaattcaagacagttgaa
ggtcgtgaaaagggaattgaaaacttaaaaaaattcggtattgaaggacttgtagtcatt
ggtggagacgggtcatttatgggagcgaagaaattaacagagctcggttttccatgtgta
ggtgtccctggcacgattgacaacgatattccaggtactgatttcactattggctttgat
acagcactgaatactgtcattgatgccattgataaaattcgtgatacagccacatctcat
gaacgtacatacgtagtggaagtaatgggaagacatgctggtgatattgccctttggtca
ggtcttgcgggcggagccgaatctattttgattcctgaagcagactatgacatggacgaa
attattgctaggttaagaagaggtcacgagcgcggcaagaagcatagtattattatcgtt
gcagaaggcgtaggcagcggtgttgaatttggtaagcggattgaagaggagacaagcctt
gaaacacgtgtatctgtcttaggacatattcagcgcggaggttctccgagtgcatttgac
cgtgtactggcaagccgtttaggagcatacgcagtcgagcttctccttgaaggacaaggc
ggacgctgtgtaggcattcaaagcaatgaacttgtccatcatgatattttagaaatctta
gataaaaaacatacagtcgataaaaatatgtaccgactttcacaagagctctctatataa

DBGET integrated database retrieval system