KEGG   Bacillus sp. WP8: QR42_17180
Entry
QR42_17180        CDS       T03530                                 

Definition
(GenBank) aspartate aminotransferase
  KO
K19549  bacilysin biosynthesis transaminase BacF [EC:2.6.1.-]
Organism
bacw  Bacillus sp. WP8
Pathway
bacw00998  Biosynthesis of various secondary metabolites - part 2
bacw01100  Metabolic pathways
bacw01110  Biosynthesis of secondary metabolites
Module
bacw_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:bacw00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    QR42_17180
Enzymes [BR:bacw01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     QR42_17180
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-ProteinID: AIZ62337
UniProt: A0A0B4SDM8
LinkDB
Position
3395237..3396430
AA seq 397 aa
MKILPSNVIERLPEQKFGTVFEKIAHKAQNGANIINLGQGNPDLPTPAHIVSALQEAAGT
LEFQQYAPFRGFDFFKQAIADFYKKEFETEIDPQKEVALFNGGKTGLYVMSQCLLDPGDI
ALVPDPGYPEYHSGILMADAKPYCIKLETKNGYLPNLSSIDPEVLKKAKVLFLNYPNNPT
GAVANDAFFEEAADFASAHGLHVIHDFAYGSFHYEQKPVSFLKAPLGKSVGVELYSLSKT
FNMAGWRVAFAVGNEDIIQAINAFQDHVFVSMYGGFQQAATVALQSDDHHIQSLKEVYLE
RIHFFIRQAEKQLGWSIERPAGAFYLWAPIPDEFEHSHAFADYLLEHTDVVVTPGGVFGA
HGKRHVRISMVAPIEQLALFIDRLRILPIRFNQKTRI
NT seq 1194 nt   +upstreamnt  +downstreamnt
gtgaagatcttaccatctaacgtgattgaacggctgccagaacagaaatttggaaccgtc
tttgagaaaattgcgcataaagcacaaaacggggcgaacatcatcaaccttgggcaggga
aatcctgatcttccgactcctgcacatatcgtaagcgcgcttcaagaggcagcaggcact
ttagagtttcagcagtatgcaccttttagaggcttcgactttttcaagcaagccattgca
gatttctacaaaaaagaattcgagactgagatagacccacagaaagaagtggcccttttc
aatggggggaaaacaggcctttatgtcatgagtcagtgtctgcttgacccaggggacatt
gccctcgtccccgatccaggatacccagaatatcattctgggatcttgatggcagacgca
aagccctactgcatcaaacttgaaacgaaaaatggctatttgccgaatctctcttcaatt
gatccggaggtgctcaaaaaggcaaaggttcttttcttaaattatccgaataacccaaca
ggtgctgtggcaaatgatgcattttttgaagaggctgctgattttgcatcggctcacgga
ctgcatgtcattcatgattttgcctatggttcatttcattatgagcaaaaaccagtaagc
tttctgaaagctcctcttggaaaaagtgtaggagtagaattatattctctatccaaaaca
tttaatatggcaggatggagagtcgcttttgctgtaggtaatgaggacatcatccaagcc
attaacgccttccaagatcatgtgtttgtcagtatgtatggcggatttcaacaagccgca
accgtcgccttgcaaagtgatgaccatcacattcaatcattaaaagaggtctaccttgaa
cgaattcacttcttcatccgtcaggcagaaaagcagctaggatggtccatcgaacgtcca
gctggcgccttttatttatgggctccaatccctgatgagtttgaacattctcatgcattt
gcagactatttactcgaacataccgatgtcgttgtcacgcccgggggggtgtttggagca
catggaaaacgtcatgtccgcatctcaatggttgctccaattgaacagcttgccctgttt
atcgaccggcttcgcatccttccgattcgctttaatcaaaaaacccgcatctag

DBGET integrated database retrieval system