KEGG   Bacillus sp. YP1: QF06_00845Help
Entry
QF06_00845        CDS       T03701                                 

Definition
(GenBank) aspartate phosphatase
  KO
K06361  response regulator aspartate phosphatase C [EC:3.1.-.-]
Organism
bacy  Bacillus sp. YP1
Pathway
bacy02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bacy00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    QF06_00845
Enzymes [BR:bacy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     QF06_00845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RapH_N TPR_12 TPR_1 TPR_2 TPR_8 TPR_MalT TPR_16 TPR_7 TPR_6 ANAPC3
Motif
Other DBs
NCBI-ProteinID: AJO57073
LinkDB All DBs
Position
199543..200691
Genome map
AA seq 382 aa AA seqDB search
MKSGVIPSSAVGQKINEWYRYIRTFSVPDAEVLKAEIQQELKHMQHDSNLLLYYSLMEFR
HQLMLDYLEPLEKLNIEDQPSLSELSRNIDSNQADLKGLLDYYVNFFRGMYEFDKREFIS
AITYYKQAEKKLSFVADHIERAEFYFKIAEAYYYMKQTYFSLINIKNAYEIYVEQETYNV
RIIQCHFVFGVNLMDERNFEQAARHFKLALNMAQAEQKAQLVGRAYYNLGLCYYNQDLLD
PAIDYFEKAVFTFESSRIVNSLPQAYFLITLIYYKQGKHDKASEYHKRGYEYAKETDDAD
YAVKFEFLQSLYQDQPNEEGIERCFQYLKNKNMYADIEDLALEVAKYYYEQKWFKLSASY
FLQVEEARKQIQRSEGLYEIEI
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcggggtaattccttcttcagcggtcggtcaaaaaattaacgagtggtacaga
tatatccggacattcagcgtgccggatgccgaagtgttaaaagctgaaatccagcaggaa
ctgaaacacatgcagcatgattccaacttgctgctttattattcactaatggaattccgg
caccagcttatgctggattatcttgagccgttagagaaattaaatatcgaagaccagcca
agcctgtctgaattatcaagaaacattgacagcaaccaggcagatctcaaagggctgctc
gactattacgtgaatttttttcgcgggatgtatgaatttgataagcgggaatttatttct
gccattacatactataaacaggcggagaaaaagctctcctttgtcgcagaccatattgaa
cgggctgaattttattttaaaatcgcggaagcttattattatatgaagcaaacgtatttt
tcattgattaatataaaaaacgcctatgaaatttacgtggagcaggaaacctataatgtg
agaatcattcaatgccatttcgtcttcggggtcaacctgatggatgaaagaaatttcgaa
caagccgcacgccatttcaaattggcgctcaatatggcccaagcggaacaaaaagcccag
ctggtcggaagagcatactacaatctcggattatgctattacaatcaagaccttctagac
cctgccattgattactttgaaaaagcggtcttcacatttgaaagcagcaggatcgtcaat
tctctcccgcaagcctattttttaatcaccctgatttattataaacagggaaaacatgat
aaagcttcggaatatcacaagcggggctatgaatatgctaaagaaacagacgatgcagac
tatgccgtaaaattcgagtttttgcaatccctatatcaggatcagcccaatgaagaagga
atcgaacgatgtttccagtacttaaaaaataaaaatatgtacgctgatatagaggattta
gccctagaagtagcaaaatattactatgaacagaaatggtttaaactgtctgcttcctac
tttctacaagttgaagaggcaagaaaacaaatacaaaggagtgaaggtttgtatgaaatt
gaaatctaa

DBGET integrated database retrieval system