KEGG   Bacillus sp. YP1: QF06_00880Help
Entry
QF06_00880        CDS       T03701                                 

Definition
(GenBank) iron ABC transporter ATP-binding protein
  KO
K02013  iron complex transport system ATP-binding protein [EC:7.2.2.-]
Organism
bacy  Bacillus sp. YP1
Brite
KEGG Orthology (KO) [BR:bacy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bacy02000]
    QF06_00880
Transporters [BR:bacy02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter
    QF06_00880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_29 AAA_14 RsgA_GTPase ATPase_2 AAA_30 AAA_23 AAA_16 Rad17 AAA_22 SbcCD_C AAA_27 AAA_25
Motif
Other DBs
NCBI-ProteinID: AJO57080
LinkDB All DBs
Position
204970..205728
Genome map
AA seq 252 aa AA seqDB search
MVEVRNVSKQYGGKVVLEETSVTIQKGKITSFIGPNGAGKSTLLSIMSRLIKKDSGEIYI
DGQEIGACDSKELAKKMSILKQANQINIRLTIKDLVSFGRFPYSQGRLTEEDWVHINQAL
SYMKLEDIQDKYLDQLSGGQCQRAFIAMVIAQDTDYIFLDEPLNNLDMKHSVEIMKLLKR
LVEELGKTIVIVIHDINFASVYSDHIVALKNGRIVKEGPPEEMIETSVLEEIYDMTIPIQ
TIDNQRIGVYFS
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggtagaggtcagaaatgtaagcaaacaatatggcgggaaagttgttcttgaagagacg
tcagtcacgattcaaaagggcaaaatcacctcgtttatcggtcctaacggcgccggcaaa
agtacgctgctgtctatcatgagccgcctgatcaaaaaggattccggcgagatttacata
gacggacaagagattggagcatgtgacagcaaagagcttgccaagaaaatgagcattttg
aagcaggcgaaccaaatcaatatcaggctcacgatcaaagacctcgtcagttttggcagg
tttccgtactcacagggccggctgacagaggaagactgggttcatatcaaccaggcgctc
agctatatgaagctggaagacattcaagacaaatacttggatcagctgagcggcggacag
tgccaaagggcatttatcgccatggtcattgcccaggacacagattatatttttctggat
gagccgctgaacaatctggatatgaaacactcagttgaaattatgaaactgctgaaacgg
ctggtagaggagcttggaaaaacgatcgtcatcgttattcacgatatcaattttgcttca
gtctattctgaccatatcgtcgctttgaaaaacggccgaatcgtaaaagaaggaccacct
gaagaaatgatagaaacgtcagtgcttgaggaaatctacgatatgaccatcccgattcag
acgattgataatcaaagaataggtgtttatttttcttaa

DBGET integrated database retrieval system