KEGG   Bacillus sp. YP1: QF06_02580Help
Entry
QF06_02580        CDS       T03701                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K21802  vanillin dehydrogenase [EC:1.2.1.67]
Organism
bacy  Bacillus sp. YP1
Pathway
bacy00627  Aminobenzoate degradation
bacy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bacy00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    QF06_02580
Enzymes [BR:bacy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.67  vanillin dehydrogenase
     QF06_02580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AJO57389
LinkDB All DBs
Position
548845..550302
Genome map
AA seq 485 aa AA seqDB search
MFQYEELNKQFIGGKWQEGSSPNVLENKNPYTQKTFTTFRKATADDVDEAYRAAALAKKK
WDAVNPFEKRTILEKAVTYIEENEEAIIYLIMEELGGTRLKAAFEIGLVKNIMKEAATFP
IRMEGKILPSTIDGKENRLYRVPAGVVGVISPFNFPFFLSMKSVAPALGAGNGVVLKPHE
ETPICGGTLIAKIFENAGIPAGLLNVVVTDIAEIGDSFVEHPVPRIISFTGSTKVGSYIG
QLAMKHFKKPLLELGGNSAFIVLEDADIEYAVNAAVFSRFTHQGQICMSANRVLVHSSIY
DKFLELYQAKVESLKVGDPMDPDTIIGPLINSRQTDGLMKTVEQAIEEGAVPVKLGGFNG
TIVEPTILKDVKPFMSIAKEELFGPVVSFMKFDSEDEAVDIANETPFGLSGAVHTSNLER
GVAFAKRIETGMIHVNDTTINDEPNVAFGGEKQSGLGRLNGEWSLEEFTTLKWISVQHKK
RSFPY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaatatgaagagttgaataaacagtttatcggcgggaaatggcaggagggcagc
agcccaaatgtattggaaaacaaaaatccttatactcaaaaaacattcacaacattccgt
aaagcgactgctgacgatgtagatgaagcgtatcgggcagcggcgctggcaaagaaaaaa
tgggatgcggtcaatccgtttgagaaaagaaccattttagaaaaagccgtcacgtatatt
gaagaaaatgaagaagccattatttatttgattatggaggagctaggcggtacaaggctc
aaagcggcttttgaaataggacttgtcaaaaacatcatgaaagaagcggcaacgttccca
atccgcatggaggggaaaattcttccgtccacaatagatggcaaggaaaacagattatat
cgcgtgccggcaggcgttgtcggtgtcatcagcccgtttaacttcccattctttttatct
atgaaatcagtggcgcctgcactcggagccggcaatggcgttgtgctaaagccgcatgag
gaaacgccgatttgcggcggaacattgatcgcgaaaatttttgagaacgcgggaattcca
gcggggctgctgaatgttgttgtcacagacattgcagaaatcggcgacagctttgttgag
catccagtgccgcggatcatctcatttaccggttctacgaaagtcggcagctacatcgga
cagcttgcgatgaagcattttaaaaagccgcttcttgagcttggcggaaacagcgctttc
atcgtacttgaggatgcagatatagaatatgcggtcaatgcggcggtgttcagccgattt
acacatcaaggacagatttgcatgtcagccaaccgcgtgcttgttcattcttctatttat
gacaagttccttgagctgtaccaggcaaaagtggaatcgctgaaagtcggcgacccaatg
gatcctgatacgattatcgggccattaatcaacagcagacagacggacgggctgatgaag
actgttgagcaagcaattgaagaaggcgctgtaccagtgaagcttggcggatttaacggg
acgatcgtggaaccgacgatcttaaaagacgtcaaaccgttcatgagcattgccaaggaa
gagctgttcggaccagtcgtctcctttatgaagtttgattcagaagacgaagcggtggat
atcgcaaacgaaaccccgtttggcttgagcggtgccgtacatacgtcaaatcttgagcgc
ggcgtggcttttgcgaaacgcattgaaacaggcatgattcacgtcaatgacacgaccatc
aatgatgaaccgaatgtagccttcggcggtgaaaagcaatcaggcctcggccgtttaaac
ggtgagtggagcctcgaagaatttacaacgctgaaatggatctcggtccagcacaaaaaa
cgcagcttcccttattaa

DBGET integrated database retrieval system