KEGG   Bacillus sp. YP1: QF06_06910Help
Entry
QF06_06910        CDS       T03701                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bacy  Bacillus sp. YP1
Brite
KEGG Orthology (KO) [BR:bacy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacy01001]
    QF06_06910
Enzymes [BR:bacy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     QF06_06910
Protein kinases [BR:bacy01001]
 Serine/threonine kinases: Other
  Bacterial family
   QF06_06910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kinase-like Kdo Haspin_kinase RIO1 Seadorna_VP7 Pkinase_fungal PBP1_TM
Motif
Other DBs
NCBI-ProteinID: AJO58198
LinkDB All DBs
Position
1390692..1392638
Genome map
AA seq 648 aa AA seqDB search
MLIGKRISGRYQILRVIGGGGMANVYLAEDIILDREVAIKILRFDYANDNEFIRRFRREA
QSASSLDHPNIVSIYDLGEEDDIYYIVMEYVEGMTLKEYITANGPLHPKEALNIMEQIVS
AIAHAHQNQIVHRDIKPHNILIDHMGNIKVTDFGIATALSSTTITHTNSVLGSVHYLSPE
QARGGLATKKSDIYALGIVLFELLTGRIPFDGESAVSIALKHLQAETPSAKRWNPSVPQS
VENIILKATAKDPFHRYETAEDMEADIKTAFDADRLNEKKFTIQEDEEMTKAIPIIKDEE
LAKAAGEKEAEVTTAQENKTKKNGKRKKWPWVLLTICLVFITAGILAVTVFPSLFMPKDV
KIPDVSGMEYEKAAGLLEKEGLQVDSEVLEISDEKIEEGLMVKTDPKADTTVKEGATVTL
YKSTGKAKTEIGDVTGQTVDQAKKALKDQGFKHVTVNEVNDEKNAGTVIDQNPSAGTELV
PSEDQVKLTVSIGPEDITLRDLKTYSKEAASGYLEDNGLKLVEKEAYSDDVPEGQVVKQK
PAAGTAVKPGNEVEVTFSLGPEKKPAKTVKEKVKIPYEPENEGDELQVQIAVDDADHSIS
DTYEEFKIKEPTERTIELKIEPGQKGYYQVMVNNKVVSYKTIEYPKDE
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
gtgctaatcggcaagcggatcagcgggcgttaccaaattctccgcgttataggcggcggg
ggaatggccaacgtctatttagctgaggatatcattctagaccgtgaagtcgcaattaaa
atcctgcggtttgactatgcaaatgacaatgaatttatcagacgtttccgcagagaagcc
caatccgcatcaagcctcgatcacccgaatattgtcagcatttacgatttgggcgaggaa
gatgatatttattatattgtcatggaatacgttgaaggcatgacgcttaaagaatacata
acagcaaatgggccgcttcaccctaaagaagcgctgaacatcatggagcaaatagtctca
gccatcgctcatgcccatcaaaaccagattgttcacagagacatcaagccgcataacatt
ttgattgatcatatgggaaatatcaaagtaacggattttggaattgcgacggcactaagt
tcgaccacaatcacccataccaattcagttctgggctcggtccattacttatcacctgaa
caggcccggggcggcttagccacaaaaaaatcggatatttatgcgcttggaatcgttcta
tttgagcttttaaccggccgtattccgtttgatggagagtcagcagtcagcatcgccttg
aagcatcttcaagcggaaactccttcggcaaaaaggtggaatccatcggtcccccaaagc
gttgaaaacatcatactcaaggcaactgccaaagatccttttcatcgctacgaaacggct
gaagacatggaagcagacataaaaacagcttttgatgccgacagactcaatgaaaagaaa
tttacgattcaagaagatgaagaaatgacaaaagcgatacctatcattaaagatgaagaa
cttgctaaagctgctggcgaaaaagaagctgaagtgacaaccgcacaagaaaacaaaaca
aagaaaaacggcaaaagaaaaaagtggccgtgggttttgctcacgatatgcctcgttttt
atcacagctggaattcttgctgtcactgtttttccgtcgcttttcatgcctaaggatgtc
aaaatacctgatgtctccggaatggaatacgaaaaagccgcagggctcttggaaaaagaa
ggtttacaggttgattccgaggtgttggaaatctcagatgaaaaaattgaagagggcctg
atggtaaaaacggatcctaaagcggataccacagtcaaagaaggcgccacggtcaccctt
tataagagcaccggaaaagcaaaaacggagatcggtgatgtgacaggccaaacggtcgac
caggcaaaaaaagcgttgaaggaccaagggtttaaacatgtaacagtaaatgaagtgaat
gacgagaaaaatgcgggcactgtcattgaccaaaatccttcagcagggactgagcttgtc
ccgagtgaagatcaagtcaaacttacagtcagtatcggacccgaagacattacgcttaga
gacttgaaaacctacagtaaagaagcagcgtctggatatctggaagacaacggattgaag
cttgtagaaaaagaagcatactcagatgatgttccagaaggacaggttgtcaaacaaaaa
ccagcagcaggtacggcagtaaagccgggaaacgaagttgaagtgacattctctctcgga
ccagagaaaaaacctgcgaaaacagtgaaagaaaaggtcaagatcccctacgaaccagaa
aatgaaggggacgagcttcaagtgcaaatcgcggttgacgatgcggatcacagcatctct
gacacttacgaagaatttaagataaaagagccgactgaacgaacgatcgaactaaagatt
gaacccggccaaaaagggtactatcaagtaatggtaaacaataaagttgtcagctacaaa
accattgagtatccgaaagatgaataa

DBGET integrated database retrieval system