KEGG   Bacillus sp. YP1: QF06_06995Help
Entry
QF06_06995        CDS       T03701                                 

Definition
(GenBank) chromosome segregation protein SMC
  KO
K03529  chromosome segregation protein
Organism
bacy  Bacillus sp. YP1
Brite
KEGG Orthology (KO) [BR:bacy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bacy03036]
    QF06_06995
Chromosome and associated proteins [BR:bacy03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Condensin-like complex
    QF06_06995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SMC_N SMC_hinge AAA_21 AAA_15 AAA_29 ERM DUF2647 ABC_tran
Motif
Other DBs
NCBI-ProteinID: AJO58215
LinkDB All DBs
Position
1406110..1409670
Genome map
AA seq 1186 aa AA seqDB search
MFLKRLDVIGFKSFAERISVDFVKGVTAVVGPNGSGKSNITDAIRWVLGEQSARSLRGGK
MEDIIFAGSDSRKRLNLAEVTLTLDNDDHFLPIDFHEVSVTRRVYRSGESEFLINNQPCR
LKDIIDLFMDSGLGKEAFSIISQGKVEEILSSKAEDRRSIFEEAAGVLKYKTRKKKAENK
LFETQDNLNRVEDILHELEGQVEPLKIQASIAKDYLEKKKELEHVEIALTAYDIEELHGK
WSTLKEKVQMAKEEELAESSAISAKEAKIEDTRDKIQALDESVDELQQVLLVTSEELEKL
EGRKEVLKERKKNAVQNQEQLEEAIVQFQQKETVLKEELSKQEAVFETLQAEVKQLRVQV
KEKQQALSLHNENVEEKIEQLKSDYFELLNSQASIRNELQLLDDQMSQSAVTLQRLADNN
EKHLQERRDISARKAACETEFARIEQEIHSQVGAYRDMQTKYEQKKRQYEKNESALYQAY
QYVQQARSKKDMLETMQGDFSGFYQGVKEVLKAKERLGGIRGAVLELISTEQKYETAIEI
ALGASAQHVVTDDEQSARKAIQYLKQNSFGRATFLPLSVIRDRQLQSRDAETAARHSSFL
GVASELVTFDPAYRSVIQNLLGTVLITEDLKGANELAKLLGHRYRIVTLEGDVVNPGGSM
TGGAVKKKNNSLLGRSRELEDVTKRLAEMEEKTALLEQEVKTLKHSIQDMEKKLADLRET
GEGLRLKQQDVKGQLYELQVAEKNINTHLELYDQEKSALSESDEERKVRKRKLEEELSAV
SEKMKQLEEDIDRLTKQKQTQSSTKESLSNELTELKIAAAKKEQACKGEEDNLARLKKEL
TETELALKEAKEDLSFLTSEMSSSTSGEEKLEEAAKHKLNDKTKTIELIALRRDQRIKLQ
HGLETYERELKEMKRLYKQKTTLLKDEEVKLGRMEVELDNLLQYLREEYSLSFEGAKEKY
QLETDPEEARKRVKLIKLAIEELGTVNLGSIDEFERVNERYKFLSEQKEDLTEAKNTLFQ
VIEEMDEEMTKRFNDTFVQIRSHFDQVFRSLFGGGRAELRLTDPNDLLHSGVEIIAQPPG
KKLQNLNLLSGGERALTAIALLFSILKVRPVPFCVLDEVEAALDEANVFRFAQYLKKYSS
DTQFIVITHRKGTMEEADVLYGVTMQESGVSKVISVKLEETKEFVQ
NT seq 3561 nt NT seq  +upstreamnt  +downstreamnt
atgttcctcaaacgtttagacgttataggatttaaatcatttgcagaacggatttccgta
gacttcgttaaaggcgtgacagcagttgtcgggccgaacggaagcggaaaaagcaacatc
acggatgccattcgctgggttctcggcgaacaatcggcacgctctcttcgcggcggaaaa
atggaagacatcatttttgctgggagtgattcaagaaagcgattaaatctagctgaagtt
acgcttactcttgataatgatgatcatttcttgccaattgacttccacgaggtgagtgtc
acaagacgtgtgtacagatcaggtgagagtgagtttctgattaacaatcagccatgccgc
ttgaaagatattattgatttatttatggactctgggcttggtaaagaagcattttctatt
atcagccaagggaaagtggaagagatcctgagcagcaaagcggaggatcgccgcagtatc
tttgaagaagcggccggggtgcttaaatataaaacgagaaagaaaaaagcagaaaataaa
ctgtttgagacacaggacaatctaaatcgggtagaagatatattacatgagcttgaagga
caggttgaacctcttaaaattcaagcttcaatagcgaaagactaccttgagaaaaagaaa
gagctggagcatgttgaaattgcgctgactgcctatgatatcgaagagctgcatggtaaa
tggtcgactcttaaagagaaagtgcagatggcaaaagaagaagagcttgctgaatcgtct
gctatttctgcgaaagaagcaaagattgaggatacaagggacaaaatacaagcgcttgat
gagtcagtagatgagctccagcaagttttactggtaactagtgaagagctggaaaagctt
gaaggccgtaaagaagtcctgaaagaacgaaagaaaaacgctgtgcaaaaccaagaacag
cttgaagaagccatcgttcagttccagcaaaaagaaacggttctgaaagaagagctttcg
aagcaggaagctgtcttcgaaacgcttcaggctgaggtgaagcagttaagggtgcaagta
aaagaaaaacagcaggctctcagtcttcacaatgaaaatgtcgaagagaaaatcgagcag
ctgaaaagtgattattttgagctgttaaacagccaggcgtcgatacgcaacgaactccag
cttcttgatgaccagatgtcccaatccgctgtcacattgcagagactcgcggacaacaat
gaaaagcacctgcaggaacggcgtgatatttctgcgcgtaaagccgcatgtgaaacggaa
tttgcccgaattgagcaggagattcacagtcaagtcggtgcatatcgtgatatgcagaca
aaatatgagcagaaaaagcgccaatacgaaaaaaatgaatccgctctgtatcaggcatac
caatacgttcagcaagcgagatcaaaaaaggacatgcttgagacgatgcagggagatttc
tccggcttttatcaaggtgttaaagaagtgctgaaagcgaaagagcgccttggcggaatt
cgcggagcggttcttgagctgatttctacagaacagaagtatgaaacggccattgaaata
gcgctcggcgcttctgctcaacacgtcgtgaccgacgatgaacaatctgcccgcaaagcg
attcaatatttaaagcagaattccttcggccgggcgacgtttctgcctctttctgttatt
agagaccgccagcttcaaagccgtgacgcggaaacagccgcccggcattcatcatttctc
ggggttgccagtgaacttgtcacatttgatcctgcgtatcgaagcgtcatccagaatctt
cttggaaccgttctgatcacagaggacttaaagggtgcaaacgagcttgcgaagcttctc
gggcaccggtaccgcatcgtaacccttgagggagatgttgtgaaccccggtggttcaatg
acgggcggcgcggttaaaaagaaaaataactccctcctcggaagaagccgggagctagaa
gatgtgacgaaacggctcgctgaaatggaagagaaaacggcactgcttgaacaagaggtc
aaaacccttaagcactccattcaggatatggagaaaaaactggctgacttaagagaaacc
ggggaaggcttaaggttaaagcagcaggatgtgaaaggccagctgtacgaacttcaagtt
gccgagaaaaatatcaatacccatttagagctctatgaccaagaaaaatctgctctgtca
gaaagcgatgaagagagaaaagtgcgcaaacgcaagcttgaagaagagctctctgccgta
tctgaaaagatgaaacagcttgaagaggacatagacagactgacaaaacaaaaacaaacg
caatcctcaacgaaagagtctctctccaacgagctgactgagctgaagatcgcagcggcc
aaaaaagagcaggcttgcaagggggaagaggacaaccttgccagattaaagaaagagctc
actgaaacagagcttgcgttaaaagaagcaaaagaagacttaagcttcttaacgtcagag
atgtcatctagcaccagcggcgaagaaaagctggaagaagcagcaaaacataaattgaat
gacaaaacgaaaacgatcgaactgattgcattaaggcgcgatcagcgcatcaagcttcag
catgggcttgaaacgtatgagcgtgagctgaaagaaatgaaacgcctgtataaacaaaaa
acaacgctcttaaaagacgaagaagtcaaactcggacgaatggaagtcgagcttgataat
ttactccaatacttacgggaggaatacagcttgtcctttgagggggcaaaagagaaatat
cagcttgaaactgatccagaggaagccagaaagcgtgtgaagctgattaaactcgcaatt
gaagagctgggtaccgtgaacctcggaagcatagatgagtttgagagggtcaacgaacgg
tacaagtttctgtcggaacaaaaagaagatttaacagaagcgaaaaataccttgttccaa
gtgattgaagaaatggatgaagaaatgacgaagcgatttaacgacacattcgtccaaatc
cgctcacactttgatcaagtttttcgctccttattcggaggagggcgagctgaactgagg
ctcaccgatcctaacgatctgcttcattcaggagtcgagattatcgctcagccgccgggg
aaaaagctgcaaaacttaaacctcctgtcaggcggagagcgtgcgcttactgctatagcg
ctcttattctcaatcctaaaggttcgtccagtgccgttttgcgtccttgacgaagtagag
gctgcgctcgacgaagcgaatgtgttccgatttgcgcagtatttaaaaaaatacagcagt
gatacccagtttattgtgattacccacagaaaaggaacgatggaggaagcggatgtactt
tatggcgtaaccatgcaggaatccggtgtttccaaggtaatctccgttaagctggaagaa
acaaaagaattcgttcagtaa

DBGET integrated database retrieval system