KEGG   Bacillus sp. YP1: QF06_11725
Entry
QF06_11725        CDS       T03701                                 

Definition
(GenBank) PTS system fructose-specific transporter subunits IIA
  KO
K11194  fructose PTS system EIIA component [EC:2.7.1.202]
Organism
bacy  Bacillus sp. YP1
Pathway
bacy00051  Fructose and mannose metabolism
bacy02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bacy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    QF06_11725
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    QF06_11725
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bacy02000]
    QF06_11725
Enzymes [BR:bacy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     QF06_11725
Transporters [BR:bacy02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    QF06_11725
SSDB
Motif
Pfam: EIIA-man
Other DBs
NCBI-ProteinID: AJO59108
LinkDB
Position
complement(2375569..2376009)
AA seq 146 aa
MISVIISGHGDFPIALKESSGMIFGEENNLIAVPFFKGEGIQTLQEKYHQALKDIPEEHE
VLFLVDIFGGTPYNAAASFIAEDQRMDMAAGVNLPILLEVLSLREHLALKDLLNNLKAMS
QQSFQVCSEHLEKVKTANQDTREDEL
NT seq 441 nt   +upstreamnt  +downstreamnt
atgatttcagttattatcagcggtcatggagattttcccatagcattaaaagagtcttca
gggatgatattcggtgaagaaaataacctgattgcagtgccgtttttcaaaggggaagga
atacaaacgctgcaagaaaaatatcatcaggcgctcaaggatatcccggaagaacatgaa
gtgctttttttagtcgatatttttggagggacgccatataacgcggcagcttcctttatt
gctgaggatcaaagaatggatatggctgccggcgtaaacctgccgattctgctggaggta
ttaagcctgagagaacatctggctctcaaagatttgctgaacaacttaaaagcaatgagt
cagcaaagctttcaagtgtgcagtgaacatttagaaaaagtaaaaacagccaatcaagat
acaagagaggatgaattatga

DBGET integrated database retrieval system