KEGG   Bacillus sp. YP1: QF06_14295Help
Entry
QF06_14295        CDS       T03701                                 

Definition
(GenBank) hypothetical protein
Organism
bacy  Bacillus sp. YP1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2278 DUF4597
Motif
Other DBs
NCBI-ProteinID: AJO59573
LinkDB All DBs
Position
2892938..2893615
Genome map
AA seq 225 aa AA seqDB search
MAVQQYGVLKGIVLDMKRETDDDSPHFQVKMLGEENTYYRCAINVMSSSEESEVLYLADD
QFDSGSITILPNMPYGYTRINEANREVALDYVRGNLFDPREMKPLPHEITGPDNDLNDFI
ETYMKKAQDEKAPVYIFGSKFGPEQAADKIFGFTPTNGMHNIHMNQGNAMDTRWKKDNGS
WHDGGILIQFADQWAAVFLAFLSQSWCTDENGNPVRDCDHTQTSA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggctgttcagcaatatggcgtgttaaaaggcatagtcttagacatgaagcgggaaaca
gatgatgacagtcctcatttccaagtcaaaatgctcggtgaagagaatacgtattacagg
tgcgccatcaatgtgatgtccagttctgaggaatctgaagtattgtatttggctgacgat
cagtttgattcgggctcaattaccatccttccgaacatgccgtatggatatacaaggatc
aatgaagcaaaccgtgaagtggcactggattatgtgcggggcaatttgtttgacccgcgg
gaaatgaagcctttgcctcatgaaatcacaggacctgataatgatttaaatgattttatt
gaaacctatatgaagaaagcacaagatgagaaagcgccggtttatatattcggttcaaaa
ttcggccctgaacaggctgcagataaaatattcggctttaccccgactaacggaatgcac
aatatccatatgaatcaagggaatgcaatggatacgcgctggaaaaaagacaacggctct
tggcatgacgggggtattctgattcagtttgcagatcagtgggccgctgtgtttttagcg
tttttatcccaatcttggtgtaccgatgaaaacggaaacccggtcagagattgtgatcat
acccaaacgtctgcgtaa

DBGET integrated database retrieval system