KEGG   Bacillus sp. YP1: QF06_14475Help
Entry
QF06_14475        CDS       T03701                                 

Definition
(GenBank) hypothetical protein
Organism
bacy  Bacillus sp. YP1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spore_YhcN_YlaJ
Motif
Other DBs
NCBI-ProteinID: AJO59604
LinkDB All DBs
Position
2933037..2933669
Genome map
AA seq 210 aa AA seqDB search
MKRTAVSLCLLTGLLSGCGGAGLDNAQNVRNQTQNQTKPIHVSDRNEAFNRHNENEQFGY
VRYQKEQFDGDQQKTPVMNREETAHMISSLTVQLPHIQDAATLVTDREALVVYKTDSKNR
ELTADQVKKTAASVIPRYYHVYISDNPNHMQSVENYSNLGSGSRDIREIMSGTIQEMKTS
PQGSPVSENENANGETRQDMKIDRNDKNAR
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaaccgctgtcagcctctgcctgctgaccggactattatccgggtgcggaggc
gcaggattggataatgcacaaaatgtccggaatcagacgcagaatcaaaccaaacccatt
catgtgtcggaccgcaacgaggcttttaacaggcataatgagaacgaacaatttggctat
gttcgctatcaaaaagaacaatttgacggagaccagcagaaaacgccggtgatgaaccgg
gaagaaaccgctcacatgatatcaagtttaacggttcagctcccccatattcaagatgct
gcgacattggtgactgaccgagaagcgcttgtcgtatacaaaaccgattctaaaaaccgg
gagctgaccgccgatcaggtgaaaaaaacagcggcttccgtgataccgcgatactatcac
gtgtatatttccgataatccaaaccatatgcagtccgtcgaaaattacagcaatctcggc
tctggttcaagggatattagagagatcatgtcggggacgattcaagaaatgaaaacctcc
ccgcaaggaagccctgtctcagagaatgaaaatgccaatggagaaacgcgccaggacatg
aaaatcgataggaatgacaaaaacgccagatga

DBGET integrated database retrieval system