KEGG   Bacillus sp. YP1: QF06_14745Help
Entry
QF06_14745        CDS       T03701                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K07516  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
bacy  Bacillus sp. YP1
Pathway
bacy00071  Fatty acid degradation
bacy00362  Benzoate degradation
bacy00650  Butanoate metabolism
bacy01100  Metabolic pathways
bacy01120  Microbial metabolism in diverse environments
bacy01200  Carbon metabolism
bacy01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bacy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    QF06_14745
  09103 Lipid metabolism
   00071 Fatty acid degradation
    QF06_14745
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    QF06_14745
Enzymes [BR:bacy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     QF06_14745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 NAD_binding_2 ApbA DUF3298 Lipase_GDSL_3 DUF4342
Motif
Other DBs
NCBI-ProteinID: AJO60772
LinkDB All DBs
Position
complement(2983364..2985733)
Genome map
AA seq 789 aa AA seqDB search
MHKHIRKAAVLGSGVMGSGIAAHLANIGIPVLLLDIVPNDLTKEEEKKGLTKDSSEVRSR
LSRQAMKKLLKQKPAPLTSAKNTSYITPGNLEDDAEKLKEADWIIEVVVENLEVKKKIFA
LVDEHRKTGSIVSSNTSGISVQEMAEGRSDDFKAHFLGTHFFNPARYLKLLEIIPIKETD
PDILKFMTAFGENVLGKGVVTAKDTPNFIANRIGTYGLLVTVQEMLKGGYQVGEVDSITG
PLIGRPKSATFRTLDVVGLDTFAHVARNVYDKADGDEKEVFRIPSFMNDMLEKGWIGSKA
GQGFYKKEGKTIYELDPVTLTYGERTKMKSPALEAAKQAKGTKAKMKALIYSDDRAGRLL
WNITSQTLLYSAELLGEIADDIHAIDQAMKWGFGWELGPFEMWDAIGLKQSAEKLEQLGA
DMPGWIKEMLDKGNETFYIKENGTVFYYDRGEYRAVKENKKRIHLQALKETKGVIAKNSG
ASLIDLGDDVALLEFHSKSNAIGLDIIQMIHKGLEETERNYKGLVIGNQGKNFCVGANLA
MILMEVQDDNFLEVDFVIRRFQETMMKIKYSAKPVVAAPFGMTLGGGTEACLPAARIQAA
SEAYMGLVESGVGLIPGGGGNKELYINHLRRGHDPMNAAMKTFETIAMAKVSASAQEARE
MNILKETDQISVNQDHLLYDAKQLAASLYDTGWRPPVKEKVKVPGETGYAALLLGAEQMK
LSGYISEHDFKIAKKLAYVIAGGKVPFGTEVDEEYLLEIEREAFLSLSGEAKSQARMQHM
LVKGKPLRN
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaacacattcggaaggcagccgttttaggatcgggggtaatgggttccgggata
gcggcgcatttggctaacatcggaattcctgtcctgctgctagatattgtgccgaacgat
ttgacaaaggaagaggaaaaaaaggggctgacgaaggacagttcggaggtgcgcagcagg
ctgagccggcaggcgatgaaaaaactgctgaaacaaaagcccgctcccctcacatcagcg
aaaaatacctcctatattacacctggcaatctggaggatgatgcagaaaaactgaaagaa
gcagattggattattgaggtcgttgtcgaaaaccttgaagtcaaaaagaaaattttcgct
cttgtggatgaacatcgaaagactggaagcatcgtctcaagcaacacatccggcatatca
gtgcaggaaatggctgaaggccggtcggatgattttaaagcccattttcttggaacgcat
ttttttaatcccgcacgatatttaaagctgctagagatcattccgattaaggaaacggat
cctgatattttaaagtttatgacagctttcggagaaaatgtcctcgggaaaggcgttgtt
acagcaaaggacacaccgaactttatcgcaaaccgcatcgggacttacgggcttctcgtg
acagtccaagaaatgctgaaaggcggttatcaggtcggggaggttgattcgatcacagga
ccgctgatcggcaggccgaaaagcgccacctttagaacgcttgatgtggtcggcctcgat
acattcgcccacgttgcccgaaatgtgtatgacaaagctgatggcgatgaaaaagaagtg
tttcgcattccaagcttcatgaacgatatgctggaaaaagggtggatcggaagcaaggcc
ggccaaggcttttataaaaaagaaggaaaaacgatttatgagcttgacccagtgacgctt
acttacggcgagcggacaaaaatgaaatcaccggcacttgaagcggcaaaacaggcaaaa
gggacaaaagccaaaatgaaagcgcttatttattcggatgacagggccggccgtttgctg
tggaatatcacttctcaaaccctgctttactcagccgagctgcttggcgagattgccgat
gatattcatgcgattgaccaagccatgaagtggggattcggctgggaactgggacctttt
gagatgtgggacgccatcggcctcaagcagtcagcggaaaagcttgagcagcttggagca
gatatgcctggctggataaaagagatgctggacaaaggaaatgaaaccttctacatcaaa
gagaacggaacggtattttattatgaccgcggcgaatacagagccgtgaaagaaaacaaa
aaacgaattcatttacaagcacttaaagaaacaaaaggcgtgattgcgaaaaacagcgga
gcaagcttaattgaccttggagatgatgtggcccttcttgaatttcattcgaaaagcaat
gcgatcggcctcgatatcattcaaatgatccacaaaggattagaggaaacagaacggaat
tacaaggggcttgtcatcggcaatcaagggaaaaatttctgcgtcggcgcgaatctcgcc
atgatcttaatggaagtccaagatgacaactttttggaagttgattttgtgatccgccgt
tttcaggagacgatgatgaagatcaaatacagtgcgaaaccggtcgtcgccgcgccattt
ggcatgacgctcggcggaggaacggaagcatgcctgccggcggcgcgcattcaagcggca
agcgaagcctatatgggacttgtggaatccggtgtcggcctcatccctggcggaggaggt
aacaaagagctgtacatcaaccatcttcgccgcggccatgatccgatgaatgcggcaatg
aaaacatttgaaacaatcgcgatggcgaaagtgtccgcttccgctcaagaggctcgtgag
atgaacatcttaaaagaaacggatcagatcagcgtgaatcaagaccacctgttatacgat
gcgaagcagctggccgcatctttatacgataccggctggcggccgcctgtaaaagaaaag
gtcaaggtgccgggagaaaccggttatgcggcactcttgcttggcgctgagcagatgaag
ctgtccggctatatatctgagcatgattttaagatcgcgaaaaaactcgcttatgtcatt
gcgggcggaaaagtgccgtttggtacagaggttgatgaagagtatttattggagatcgaa
agagaagcgtttttgagtttgtcaggagaggcaaaatctcaagcgagaatgcagcatatg
cttgtgaaaggtaaacctttacggaattag

DBGET integrated database retrieval system