KEGG   Bacillus sp. YP1: QF06_15870Help
Entry
QF06_15870        CDS       T03701                                 

Definition
(GenBank) pyrophosphatase
  KO
K06019  pyrophosphatase PpaX [EC:3.6.1.1]
Organism
bacy  Bacillus sp. YP1
Pathway
bacy00190  Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:bacy00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    QF06_15870
Enzymes [BR:bacy01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.1  inorganic diphosphatase
     QF06_15870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD DUF1320 Hydrolase_3
Motif
Other DBs
NCBI-ProteinID: AJO59868
LinkDB All DBs
Position
complement(3214934..3215584)
Genome map
AA seq 216 aa AA seqDB search
MSDKQVTTILFDLDGTLINTNELIIASFLHTLEHYYPSKYKREDVLAFIGPSLFETFSSM
DPDKCEDMIAMYRAYNHDMHDSLVTEYETVYETLEALKKAGFTLGIVTTKLRDTVNMGLK
LTGIGEFFETVVTLDDVTNAKPDPEPVLLALKQLGSKPEEAIMVGDNYHDVLAGKNAGTK
TAGVAWTIKGPEMLAKHEPDFMLEKMSDLLQIVGVK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacaaacaagtaacgacgattctgtttgatttagacggaacgcttattaatacg
aatgaattaattatcgcgtcctttttgcatacactggagcattattatccgagcaagtat
aaacgagaagatgtccttgcgtttatcgggccgtctctttttgaaacgttctcttcgatg
gaccctgataaatgcgaggatatgatcgccatgtacagagcatacaatcatgacatgcat
gattcactcgtgactgaatatgaaacggtatatgagactctggaagcattaaaaaaagcc
ggctttacattagggattgtgacaacaaaattaagagatactgtcaatatgggcctcaag
ctcacgggaatcggcgaattctttgaaacagttgtcacccttgatgatgtgacgaatgca
aagcctgatcccgagcctgtgctgttagcgctgaaacagttaggaagcaagcccgaggaa
gccattatggtcggagataattaccacgatgtgctggcaggcaaaaacgccggtacaaaa
acggcaggagtcgcatggacgattaaagggccggaaatgctggcgaagcatgagccggat
tttatgcttgagaaaatgagtgatctattacaaatcgttggagtgaagtaa

DBGET integrated database retrieval system