KEGG   Bacillus sp. YP1: QF06_17285
Entry
QF06_17285        CDS       T03701                                 

Definition
(GenBank) aspartate aminotransferase
  KO
K19549  bacilysin biosynthesis transaminase BacF [EC:2.6.1.-]
Organism
bacy  Bacillus sp. YP1
Pathway
bacy00998  Biosynthesis of various secondary metabolites - part 2
bacy01100  Metabolic pathways
bacy01110  Biosynthesis of secondary metabolites
Module
bacy_M00787  Bacilysin biosynthesis, prephenate => bacilysin
Brite
KEGG Orthology (KO) [BR:bacy00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    QF06_17285
Enzymes [BR:bacy01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     QF06_17285
SSDB
Motif
Pfam: Aminotran_1_2 Alliinase_C Cys_Met_Meta_PP
Other DBs
NCBI-ProteinID: AJO60140
LinkDB
Position
complement(3508459..3509658)
AA seq 399 aa
MEITPSDVIKTLPRQEFSLVFQKVKEMEKTGAHIINLGQGNPDLPTPPHIVEALREASLN
PSFHGYGPFRGYPFLKEAIAAFYKREYGVTINPETEVALFGGGKAGLYVLTQCLLNPGDI
ALVPNPGYPEYLSGITMARAELYEMPLYEENGYLPDFEKIDPAVLEKAKLMFLNYPNNPT
GAVADAAFYARAAAFAKEHNIHLIHDFAYGAFEFDQKPASFLEAEDAKIVGAELYSFSKT
FNMAGWRMAFAVGNERIIQAVNEFQDHVFVGMFGGLQQAASAALSGDPEHTESLKRIYKE
RIDFFTALCEKKLGWKMEKPKGTFYVWADIPNTFETSHQFSDYLLEHAHVVVTPGEIFGS
NGKRHVRISMVSKQEDLREFVTRIQKLNLPFGSLQETSR
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggaaataacaccgtccgatgtcatcaagacacttccaaggcaagagttttctctcgtt
tttcaaaaggtaaaggaaatggaaaaaacgggagcccatatcattaatctcggacagggg
aaccctgaccttcccactccgccgcatattgtggaggctttgcgggaggcttctctgaat
ccttcgtttcatggatacggccctttcaggggctatccttttttaaaggaagcgatcgct
gctttctataaaagggaatacggagtgacaatcaatcctgaaacggaagtcgcgcttttc
ggaggcgggaaagccggattgtatgtgctgacacaatgcctgctcaatccgggagacatc
gctttagtcccgaatccaggctatcctgaatatttatcagggattacgatggcgcgagct
gagctttacgaaatgccgctgtatgaagaaaatggctatctgccggattttgaaaagatt
gatccagccgtgctggaaaaagcgaagcttatgtttttaaactacccgaacaaccccact
ggagctgtggctgatgcggctttttatgcaagagctgctgcttttgcgaaagagcataac
atccatttgattcatgattttgcatacggagcgtttgaattcgatcaaaaaccggccagt
tttcttgaggcagaggatgccaaaattgtcggagcagagctttattcattttcaaaaaca
tttaacatggccggctggagaatggcgtttgcggttgggaacgaaaggatcattcaggcc
gtcaatgaatttcaggatcatgtatttgtcggcatgttcggcgggctgcagcaggcagcg
agtgcggcgctttctggagatccggagcatacggaatcgttgaaacgaatttataaggaa
cgaattgacttttttacggcgctttgcgaaaagaaactgggctggaagatggaaaagcca
aaaggaaccttttacgtatgggctgatattccgaatacgtttgagacatctcaccaattt
tccgattacttgctggagcatgcccatgtcgtagtcacaccgggcgaaatttttggaagc
aacggaaaaaggcatgtcagaatctcaatggtgtcgaagcaggaggatctgcgggaattt
gtcacgcggattcaaaagctgaacctgccgttcgggtcattacaagaaacatcccgctaa

DBGET integrated database retrieval system