Bifidobacterium adolescentis ATCC 15703: BAD_0552 Help Entry BAD_0552          CDS       T00437                                  Symbol hup Name (GenBank) DNA-binding protein HB1   KO K03530   DNA-binding protein HU-beta Organism bad  Bifidobacterium adolescentis ATCC 15703 Brite KEGG Orthology (KO) [BR:bad00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:bad03032]     BAD_0552 (hup)    03036 Chromosome and associated proteins [BR:bad03036]     BAD_0552 (hup)    03400 DNA repair and recombination proteins [BR:bad03400]     BAD_0552 (hup) DNA replication proteins [BR:bad03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BAD_0552 (hup) Chromosome and associated proteins [BR:bad03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BAD_0552 (hup) DNA repair and recombination proteins [BR:bad03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BAD_0552 (hup) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_2 UPF0181 Motif Other DBs NCBI-ProteinID:  BAF39333 UniProt:  A1A0V0 LinkDB All DBs Position complement(692781..693062) Genome browser AA seq 93 aa AA seqDB search MAYNKSDLVSKIAQKSNLTKAQAEAAVNAFQDVFVEAMQSGEGLKLTGLFSAERVKRAAR TGRNPRTGETIEIPATYGVRISAGSLLKKAVTK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggcatacaacaagtctgatctcgtctcgaagatcgcccagaagtccaacctgaccaag gctcaggctgaggctgcggtgaacgctttccaggacgtgttcgtcgaggcaatgcagtcc ggcgaaggcctgaagctgaccggcctgttctccgccgagcgcgtcaagcgcgcagcccgc accggccgcaacccgcgcaccggcgaaaccatcgagattccggcaacctacggcgttcgc atctctgccggctccctgctgaagaaggccgtcaccaagtaa

DBGET integrated database retrieval system