KEGG   Bifidobacterium adolescentis 22L: BADO_0194Help
Entry
BADO_0194         CDS       T03260                                 

Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
badl  Bifidobacterium adolescentis 22L
Pathway
badl00473  D-Alanine metabolism
badl00550  Peptidoglycan biosynthesis
badl01100  Metabolic pathways
badl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:badl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BADO_0194
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BADO_0194
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BADO_0194
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:badl01011]
    BADO_0194
Enzymes [BR:badl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BADO_0194
Peptidoglycan biosynthesis and degradation proteins [BR:badl01011]
 Precursor biosynthesis
  Amino acid ligase
   BADO_0194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AII75620
UniProt: A0A076JKA8
LinkDB All DBs
Position
262823..263959
Genome map
AA seq 378 aa AA seqDB search
MAKKRIVVMYGGKADEHSISCISAASALRALDTDKFEAIPVGITKDGKWIVNGENPLGWS
LDEGLPTVEKTPGAKDVVLEVALGQDGFFAREDDGTLTPFGHVDAVFPVLHGPYGEDGTI
QGLFEMMGVPYVGCGVLASAACMDKHYTKVLLAAAGIPVAPGITLDARSFDKASEFKANA
DAIMAQVSEAGLQYPLFVKPSRAGSSFGVTKVEHEGDAAELAAAVYEASHHDWRILVEQG
IDAREIECAVLCPKAGEAPQASWPGEIVLDKRAEGDDQFYDFDSKYMDAAASHVEVPANL
PEETLNLVRETAKKAFVAVDGAGLSRVDTFVTKDGKVMVNEINTMPGFTSISMYPKAWEA
TGVRYTDLITMLIEGVLR
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaagcgcattgtggtgatgtacggcggcaaggccgacgagcattcgatctcc
tgcatctccgctgcgagtgcgctgcgcgcgctggacacggacaagttcgaagccattccg
gtgggcatcaccaaggacggcaagtggatcgtcaacggtgagaatccgctcggatggagc
ctggacgaaggcctgccgaccgtggagaaaaccccaggcgccaaggacgtggtgcttgaa
gtggctctcggacaggacggcttcttcgcccgcgaggatgacggtacgctgaccccgttc
ggccatgtggacgcggtgttccccgtgctgcacgggccgtacggcgaggacggcaccatc
cagggtctgttcgaaatgatgggcgtgccgtacgtggggtgcggcgtgctcgcctccgcg
gcctgcatggacaagcattacacgaaggtgctgcttgcggccgccggcattcccgtcgcg
cccggcatcacgctcgacgcgcgttccttcgacaaggcttccgaattcaaggccaacgcc
gatgcgatcatggcgcaggttagcgaagccggcttgcagtatccgctgttcgtcaagccg
tcccgcgccggctccagcttcggcgtgaccaaggtggagcatgagggcgatgcggccgaa
ctcgcggccgccgtgtacgaggcgtcccaccacgattggcgcatcctcgtggaacagggc
atcgacgcgcgcgaaatcgaatgcgcggtattgtgcccgaaggccggcgaagcgccgcag
gccagctggccgggcgaaatcgtactcgacaagcgcgccgaaggcgacgaccagttctac
gacttcgacagcaagtacatggacgccgccgcaagccacgtggaagtgcccgccaatctg
ccggaagagacgctgaaccttgtacgcgaaaccgccaagaaggcgttcgtcgccgtggac
ggtgccggtctgagccgcgtggacaccttcgtgaccaaggacggcaaggtgatggtcaac
gaaatcaacaccatgccgggcttcacgtccatctccatgtaccccaaggcatgggaggcc
accggcgtgcgctacaccgacctgatcaccatgctcatcgaaggcgtgctgcgctga

DBGET integrated database retrieval system