KEGG   Bifidobacterium adolescentis 22L: BADO_1434Help
Entry
BADO_1434         CDS       T03260                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
badl  Bifidobacterium adolescentis 22L
Pathway
badl00430  Taurine and hypotaurine metabolism
badl00650  Butanoate metabolism
badl01100  Metabolic pathways
badl01110  Biosynthesis of secondary metabolites
badl01120  Microbial metabolism in diverse environments
badl02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:badl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BADO_1434
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BADO_1434
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BADO_1434
   00430 Taurine and hypotaurine metabolism
    BADO_1434
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BADO_1434
Enzymes [BR:badl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BADO_1434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 DotU
Motif
Other DBs
NCBI-ProteinID: AII76842
UniProt: A0A076JJN8
LinkDB All DBs
Position
complement(1754838..1756286)
Genome map
AA seq 482 aa AA seqDB search
MSETHSTTENNNSHCCDNTCGNADDRVVPDSVEINPLFARPKEAQAFSKFTIPQKSSLPE
TAYQVVHDEAMLDGNARLNLATFVSTWMDDHANRLYMEAADKNMIDKDEYPKTAEVESRC
WHMLADLWHAPDPMNAIGTSTIGSSEACMLGGLALKRRWKEAREKADLPTDHPNLVMSSA
VQVCWEKFCNYFDVEPRYVPISEDHKVLDGHDLDKYVDENTIGVVAIMGVTYTGMYEPVE
QISEALDRIEERTGLDVRIHVDGASGGMIAPFIQPDLAWDFRVKRVYSISTSGHKYGLVY
PGLGWIVWRETADLPESLIFKVSYLGGEMPTFALNFSRPGAQVLLQYYMFLRLGFDGYRR
VQQTSHDVAKYLSGEIEQMDDFTLWNDGSDIPVFAWMLNDKPDRKWNLYDLQDRLRMKGW
LVPAYPMPVDLTQVTVQRIVVRNGFSHDMAEAFIKDLKSCVKYLDGLRSPMPSEARASGF
HH
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaacacattccaccactgaaaacaacaattcgcattgctgcgacaacacctgc
ggcaatgccgacgaccgcgttgttcctgacagcgtggaaatcaatccgctgttcgcccgt
ccgaaggaagcccaggcgttctcgaaatttaccattccacagaagagtagtctgccggaa
accgcctaccaagtggtgcatgacgaggccatgctggatggcaacgcgcgactcaatctt
gcaacttttgtgagcacgtggatggacgatcatgcgaaccgcctgtacatggaggcggcc
gacaagaacatgatcgacaaagacgagtacccgaaaaccgccgaagtcgaatcgcgctgc
tggcacatgctcgccgatctatggcatgcgcccgatccaatgaatgccatcggaacctcc
accatcggctcgtcggaagcttgcatgctgggcggactcgcgttgaagcgccgttggaag
gaagcccgcgaaaaggccgacctgccgaccgatcatccgaatctggtgatgagcagcgcc
gtgcaggtgtgctgggagaagttctgcaactatttcgacgtggaaccacgctatgtgccg
atttccgaggaccacaaagtgctcgacggccatgatctcgacaagtatgtcgatgagaac
accatcggcgtggtggccatcatgggcgtgacctatacgggtatgtatgagccggtcgaa
cagatcagcgaagcactggaccgcatcgaggagcgcaccggacttgatgtgcgcatccat
gtggacggcgcttcgggaggtatgatcgcaccattcatccagccggacctcgcatgggac
ttccgcgtcaagcgcgtttactccatcagcacctccggtcacaagtacggtctggtctac
cccggtttgggatggattgtatggcgcgaaaccgctgacctgccggaaagccttattttc
aaggtgagttatctcggcggcgaaatgccgactttcgcactgaacttctcccgtccgggc
gcacaggtactgctgcagtactacatgttcctgcgtttgggattcgacgggtatcgaagg
gtgcagcagacttcgcatgatgtggcgaaatatctgtcgggcgagatcgagcagatggat
gattttacgctgtggaacgacggttccgacattccggtgttcgcatggatgctcaacgac
aagccggatcgcaagtggaatctgtacgatctgcaggatcggctgcgcatgaagggatgg
ctggtgccggcttatccgatgccggtggatctgacgcaggtgaccgtgcagcgcattgtg
gtgcgtaacggtttcagccacgatatggccgaagcgttcatcaaggatttgaagtcgtgt
gtgaagtatctggacggactgcgttcaccaatgccaagcgaggctcgtgcatccggattc
caccactga

DBGET integrated database retrieval system