KEGG   Bifidobacterium adolescentis 22L: BADO_1447Help
Entry
BADO_1447         CDS       T03260                                 

Definition
(GenBank) oligo-1,6-glucosidase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
badl  Bifidobacterium adolescentis 22L
Pathway
badl00500  Starch and sucrose metabolism
badl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:badl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BADO_1447
Enzymes [BR:badl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BADO_1447
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     BADO_1447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 Glyco_hydro_70 zf-NOSIP
Motif
Other DBs
NCBI-ProteinID: AII76855
UniProt: A0A076JNN1
LinkDB All DBs
Position
complement(1776913..1778544)
Genome map
AA seq 543 aa AA seqDB search
MLPPAKHPHPKWLADAIFYEIYPQSFVDSNGDGIGDIPGITLKLDYIKDLGCNAIWLNPC
FDSPFKDAGYDVRDYKKVASRYGTNDDLIALFDAAHRRDMHVILDLVPGHTSEEHEWFHR
SCKVERNNYSDRYIWTDSWISGGDGLPFIGGESPRNGTYILNFFKCQPALNYGFAHPERS
WQKPALGPDAKATCDAMVDVMRFWLSRGADGFRVDMADSLVKKDDEGKPYTIRTWQYMFA
RIRPAFPEAAFVSEWGRPEESMAAGFDMDFYLDWRWDGVPNGYNMLLRNVDDPLSRKGDK
SYFNADSGTPISKFLDEYEPRLREAETADGNFNFITCNHDTARVAPRLSQREIALAYCTL
FAMPGVPFLYYGDEIGMRYRALPGKEGGYVRTGSRTPMQWGANDASGALHVSDSAESDTR
AGDVTGGSYLPADPSADAPTVAAQQADAESLWHTVRSILHVKGECDALRSGATFHAIERD
RVFVFERSTHLQKLIIAVNPSRDCKALQLPDGSYRTIFSIGENEISGTSLRLGLQSFAIL
EAE
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgcttccccccgcgaaacacccccaccccaaatggcttgccgacgcaattttttatgaa
atctatccacagtccttcgtcgactccaatggcgacggcatcggagacatccccggaatc
actttaaaactggactacatcaaggatctcggatgcaacgcgatctggctcaatccctgt
ttcgactcgccattcaaagacgccggctacgacgtgcgcgactacaaaaaggtggcatca
cgctacggcaccaacgacgatctcattgcgttgttcgacgccgcccaccggcgcgacatg
cacgtgatcctcgatctcgtgccaggccacaccagcgaggaacacgagtggttccaccgc
agttgcaaggtcgaacgaaacaattattccgaccgctacatctggacagactcatggatc
tccggtggcgacggactgccattcatcggcggcgaatcgccccgcaacggtacctacatc
ttgaacttcttcaaatgccagccggcgctcaactacggtttcgcgcaccccgaacgtagc
tggcagaagccagcccttggtccggacgcgaaggccacttgcgacgcgatggtggacgtc
atgcggttctggctttcccgtggcgcagacggcttccgcgtggatatggccgacagcctc
gtcaaaaaggacgatgagggcaagccttacaccatccgcacctggcagtacatgttcgcc
cggatccgcccggccttccccgaagccgcgttcgtttcggaatggggacggccagaggag
tcgatggccgccggcttcgacatggatttctatctcgattggcgttgggacggcgttccc
aacggctacaacatgctgttgcgcaacgtggacgacccgttgagccgcaagggcgacaag
agctatttcaacgccgattccggcacgccgatcagcaaattcctggacgagtacgagccg
cgtctgcgcgaagcggaaacggccgacggaaattttaatttcatcacctgcaaccacgac
accgcacgcgtggcgccgcgactgtcgcagcgcgaaatcgccctggcatactgcacgctg
ttcgcgatgccgggcgtgccgttcctgtattacggcgacgaaatcggcatgcgataccgc
gcactgcccggcaaagaaggcggctacgtgcgcaccggttcgcgcacaccgatgcagtgg
ggtgcgaacgacgcatccggagcacttcacgtgtccgattctgcagaatcggacactcgg
gctggcgatgtgaccggtggcagctacctgcccgccgacccgtccgccgacgccccgacc
gtcgccgcacagcaggccgacgccgaatcactgtggcatacggtgcgctccatactccac
gtcaagggggaatgcgacgccttgcggtcgggggctacgttccatgcaatcgaacgcgat
agagtgttcgttttcgagcgttccacccacctgcagaagctgatcatagccgtcaatcca
agccgcgattgcaaagctttgcagttaccagatggtagttatcggacgattttcagcatc
ggcgaaaacgaaattagcggcacttcgctgcgtctaggtctgcaaagctttgcaattctc
gaagccgagtag

DBGET integrated database retrieval system