KEGG   Bifidobacterium adolescentis BBMN23: BBMN23_0031Help
Entry
BBMN23_0031       CDS       T03774                                 

Definition
(GenBank) putative serine-threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bado  Bifidobacterium adolescentis BBMN23
Brite
KEGG Orthology (KO) [BR:bado00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bado01001]
    BBMN23_0031
Enzymes [BR:bado01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BBMN23_0031
Protein kinases [BR:bado01001]
 Serine/threonine kinases: Other
  Bacterial family
   BBMN23_0031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal Seadorna_VP7 RIO1 Haspin_kinase Kdo ABC1 Mid2
Motif
Other DBs
NCBI-ProteinID: AJE05003
UniProt: A0A076JKF0
LinkDB All DBs
Position
complement(39868..41928)
Genome map
AA seq 686 aa AA seqDB search
MNINMPTSLAGGRYQLGQLVGRGGMAEVHVATDTRLGRTVAVKIMRADFATDSIFLERFR
REAHSVAQMNNPNIVNIYDSGEETVTTETGEIEHLPYLVMEYVKGQTLRDILKVNGALSQ
RDAEQVMMGVLNALEYSHRMGIIHRDIKPGNIMISEQGVVKVMDFGIARAIDDSAATMTQ
SQGVVGTAQYLSPEQARGESVDMRSDLYSAGCVLYEMLTGRPPFTGDSAVAIAYQHVSEV
ATPPSTIVPGLPKMWDSICAKAMAKDRQNRYATASEFKNDLLTFMNGGVPMAAAFNPLTD
LTNMKARKQAEMDAATVPMAPATDAPTQAFNPVTGQFEAVPNPNGGVETKTRAEQRAKAA
QERKKKQIIIASVVGSIVVLLAVIGIFFALNGHKNTADLVSVPDFTDTSNISQARVEEQL
KALGLKLDARDDSTSSQPKGTITKQNPKGGKKVAKGSTVSVWFSTGPQAVSVPDVSGKTQ
EEAKGILEAAGFKIGNVMTVDSASIEKDKVVNTNPAAHSKQTKGTIITLYISSGMTKIPD
GLVGQAKDSVIAQLKQAGLTQITIESEYSDSVQSGAVTRIDPGSGSTVEAGTAVTIWVST
GKQQVSVPFVANSTLAEAKSILEAAGFQVSVNGPQDDDATVVSMSPNGGSQADSGSTITL
TTKKSSSDTNNTDTNNNGNTNNQQGN
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcaacatgcctacctctctggccgggggccgttatcagctcggccaactcgtc
ggccgtggcggcatggccgaagtgcatgtggcgaccgacacgcgtctggggcgtaccgtc
gccgtcaagatcatgcgcgccgatttcgccactgacagcatcttccttgagcgtttccgc
cgtgaagcccattccgtcgcgcagatgaacaacccgaacatcgtgaacatctacgattcg
ggcgaggaaaccgtcaccacggaaaccggcgagatcgagcatctgccgtatctggtgatg
gagtacgtcaagggtcagaccctgcgtgacatcctcaaggtgaatggcgcgctgagccag
cgcgacgccgagcaggtgatgatgggcgtgctcaacgcgctcgaatactcgcaccgcatg
ggcatcatccaccgcgacatcaagcccggcaacatcatgatttccgagcagggcgtggtc
aaggtcatggacttcggtatcgcccgcgcgatcgacgattccgcggccacgatgacgcag
tcgcagggcgtcgtcggcaccgcgcaatacctgtctccggagcaggcgcgcggcgaaagc
gtcgacatgcgttccgacctgtattccgccggctgcgtgctgtacgaaatgctcaccggc
cggccgccgttcaccggcgattcggcggtggcgatcgcctaccagcatgtgtcggaagtc
gccactcccccaagcacgatcgtgccgggcctgccgaagatgtgggattcgatctgcgcg
aaggcgatggccaaggatcggcagaaccggtacgccaccgcttccgagttcaagaacgat
ctgctgacgttcatgaacggcggtgtgccgatggctgccgcgttcaacccgttgaccgac
ctgaccaacatgaaggcccgcaagcaggccgaaatggatgccgccaccgtgcccatggcg
ccggcgacggatgcgccgacgcaggcgttcaacccggtcaccggccagttcgaggccgtg
ccgaatccgaatggcggagtcgaaacgaagacccgtgcggaacagcgtgccaaggccgcg
caggagcgtaagaagaagcagatcatcatcgcttccgtggtcggcagcatcgttgttttg
ctggccgtcatcggtattttcttcgcgttgaacgggcataagaacactgcggatctggtg
tccgtgccggacttcaccgacacgtcgaacatttcccaggcgcgtgtggaagaacagctt
aaggcccttggtctgaagcttgacgcccgtgacgattccacgtccagccaaccgaagggc
accatcaccaagcagaacccgaagggcggtaagaaggtggcaaagggctccaccgtctcc
gtatggttctccaccggcccgcaggcggtcagcgtgcctgacgtgtccggcaagacgcag
gaggaagcgaagggcattcttgaggcggcaggcttcaagatcggcaatgtcatgaccgtg
gacagtgcctccatcgagaaagacaaggtggtgaacaccaatccggccgcgcattcgaag
cagaccaagggcaccatcatcacgctgtacatttcgtccggcatgaccaagattccggat
ggtctggtaggccaggccaaggattcggtcatcgcgcagctcaagcaggctggtctgacg
cagatcaccatcgaaagcgagtattccgattcggtgcagtccggtgcagtcacccgcatc
gatccgggttccggcagcaccgtcgaggcgggaacggccgtgaccatctgggtgtccacc
ggcaagcagcaggtgagcgtgccgtttgttgccaactccacacttgccgaagcaaagagc
attttggaggctgccggattccaggtaagtgtcaacgggccacaggatgatgacgcgacc
gtcgtgtcgatgtcgccgaatggcggcagccaggccgacagcggatcgaccatcacgctg
accaccaagaaatcgtccagcgacacgaacaacaccgacacgaacaacaacggcaacacc
aacaaccagcaaggcaactaa

DBGET integrated database retrieval system