KEGG   Bifidobacterium adolescentis BBMN23: BBMN23_0130Help
Entry
BBMN23_0130       CDS       T03774                                 

Definition
(GenBank) putative cobyric acid synthase CobQ
  KO
K07009  lipid II isoglutaminyl synthase (glutamine-hydrolysing) [EC:6.3.5.13]
Organism
bado  Bifidobacterium adolescentis BBMN23
Pathway
bado00550  Peptidoglycan biosynthesis
bado01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bado00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BBMN23_0130
Enzymes [BR:bado01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.13  lipid II isoglutaminyl synthase (glutamine-hydrolysing)
     BBMN23_0130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3
Motif
Other DBs
NCBI-ProteinID: AJE05102
UniProt: A0A0B5BF58
LinkDB All DBs
Position
174077..174904
Genome map
AA seq 275 aa AA seqDB search
MSAARNETAQSQSKTAEGRRGDDMSQVIDIVSLYPKDMNIYGDSGNVLAIQRRLALYGYE
PRVHAYNQGCDWPEHVDMILGGGGQDTGQKKIIDDFFQRADLLRSLAADGVPMLMICGLY
QLFGEYFETVDGSRLDGIGVIGAYTVGQETRMIGNLTETSADFGKIIGYENHSGQTFLRD
GVQPLGTVEQDGTGNNGEDHTEGARVHNVIGTYMHGSLLPKNSAIADFLIRTAVERRYGT
FDPAAAGQTDAQRAALHRIDEIADRARRVAMSRPR
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccgcgcgaaacgaaaccgcgcaatcgcaaagcaaaacagcggaaggaagacga
ggagacgatatgagccaggtcatcgacatcgtgtcgctgtatccgaaggatatgaacatc
tacggcgattccggcaacgtgctcgccatccagcgccggctcgcgctgtacggctacgag
ccgcgcgtacacgcctacaaccagggctgcgactggcccgagcacgtggacatgattctg
ggtggcggcggccaggacaccggccagaagaagatcatcgacgacttcttccaacgcgcc
gacctgctgcgttcgctcgcggcggacggcgtgccgatgctgatgatctgcggcctgtac
cagctgttcggcgagtatttcgaaacggtcgacggctcccgactcgacggcatcggcgtg
atcggcgcgtacacggtcggccaggaaacacgcatgatcggcaatcttacggaaacctcc
gccgatttcggcaagatcatcggctacgaaaaccattccggacagacgttcctgcgtgac
ggcgtgcagccgctcggcaccgtcgaacaggacggcaccggcaacaacggcgaggaccat
acggaaggcgcgcgcgtccacaacgtgatcggcacgtacatgcacggctcgctgctgccg
aagaattccgcgatcgccgatttcctgatccgcaccgccgtcgaacgccgttacggcacg
ttcgatccggccgccgccggacagacggacgcgcaacgggccgccctgcatcgcatcgac
gaaatcgccgaccgtgctcgccgcgtggccatgtcccgtccgcgctga

DBGET integrated database retrieval system