KEGG   Bifidobacterium adolescentis BBMN23: BBMN23_0346Help
Entry
BBMN23_0346       CDS       T03774                                 

Definition
(GenBank) xylitol (sorbitol) dehydrogenase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
bado  Bifidobacterium adolescentis BBMN23
Pathway
bado00040  Pentose and glucuronate interconversions
bado01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bado00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BBMN23_0346
Enzymes [BR:bado01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     BBMN23_0346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: AJE05318
UniProt: A0A0B5BF17
LinkDB All DBs
Position
433167..434207
Genome map
AA seq 346 aa AA seqDB search
MKAVVLEEQGVINVREVPDVPAPGLGELKIAPHTVGVCGSDLHYYTHGRVGKYVVEQPMI
LGHEASGTVVEVGPGVEGFKVGDRVAMEPGIPDMSSRASKLGMYNVDPAVRFFATPPIDG
CLCETVNHPAAFTYKLPDNVSFGEGALLEPLAVGMWSATKARIKPGDVCVVTGSGTVGML
TASCALAGGASKVLISDVSAIKLAIAAQIPGIIPVDLTKEDLVERVREETGGWGADVAFE
CSGSPKSYETFWKLIAPGGAAVIVGIPVNPVAIDITELQATEVRIENIFRYANVYQKAID
LVANGKLNLKPFITDTYAMEDAQAAFDRMAEGRPGDIKLQITVNND
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagtcgttctcgaagagcagggcgtcatcaatgtgcgtgaggtgcctgacgtc
cccgcacctggtctaggcgagctgaagatcgcgccgcataccgttggtgtgtgcggttcc
gacctgcactattacactcatggtcgcgtgggcaaatatgtggtggagcagccgatgatt
ctcggtcatgaggcttccggcacggtggttgaggtcggtcctggcgtcgaaggcttcaag
gtgggcgatcgtgtggccatggagcccggcattccggatatgagttcgcgtgccagcaaa
ctgggcatgtataacgtcgatcctgcggtgcgtttctttgccactccgccgattgatggc
tgcctgtgcgaaacggtgaaccatcctgcggcgttcacctacaagctgcccgacaatgtg
agcttcggtgagggtgcgctgcttgaaccgttggctgtgggcatgtggtccgccaccaag
gctcgtatcaagccgggcgatgtctgcgtggtcaccggatcgggcacggtcggcatgctg
accgcgtcgtgcgcgttggcgggtggcgcttccaaggtgctgatctccgatgtgtcggca
atcaaactggcgattgcggctcagattccaggtattattccggtggatctcaccaaggag
gatctggtggagcgcgtccgcgaggaaacggggggctggggtgctgatgtggctttcgag
tgctcgggctcgccgaagtcatacgagacattctggaagctgattgctcccggtggcgct
gccgttatcgttggcattccggtcaatccggtggctatcgacattacggaactgcaggct
accgaggtgcgcattgaaaatatcttccgttatgccaatgtgtatcagaaggccattgac
ctcgtggctaacggtaaactgaatctgaagccattcatcaccgacacctatgcgatggag
gatgcccaggcggcgttcgatcgcatggccgaggggcgtcctggagacatcaagctgcag
attactgtgaataacgactga

DBGET integrated database retrieval system