KEGG   Bacillus atrophaeus 1942: BATR1942_01265Help
Entry
BATR1942_01265    CDS       T01339                                 

Definition
(GenBank) putative aldehyde dehydrogenase
  KO
K21802  vanillin dehydrogenase [EC:1.2.1.67]
Organism
bae  Bacillus atrophaeus 1942
Pathway
bae00627  Aminobenzoate degradation
bae01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bae00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BATR1942_01265
Enzymes [BR:bae01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.67  vanillin dehydrogenase
     BATR1942_01265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh YCII
Motif
Other DBs
NCBI-ProteinID: ADP31211
UniProt: A0A0H3DWP6
LinkDB All DBs
Position
268540..269997
Genome map
AA seq 485 aa AA seqDB search
MFQYEELNKQFIGGKWREGAGSSLLEDKNPYTQKNITSFRKANTDDVDEAYKSAAHAKKK
WDAVNPFEKRTILEKAVAYIEENEEAIIYLIMEELGGTRLKAAFEIGLVKNIIKEAATFP
VRMEGKILPSTIDGKENRLYRVPAGVVGVISPFNFPFFLSVKSVAPALGAGNGVVLKPHE
ETPICGGTLIAKIFEAAGIPEGLLNVVVTDIAEIGDSFVEHPVPRIISFTGSTKVGSYIG
QLAMKHFKKPLLELGGNSALIVLEDADLEYAVNAAVFSRFTHQGQICMSANRILVHSSIH
DRFLEMYQAKVESLKVGDPMDPETIIGPLINSRQTDALMKSVEKAIEEGAVPVTLGGFAG
TVVEPTILKDVKPSMSIAHEELFGPVVSVMKFDSEDEAVDIANDTPFGLSGAVHTANVER
GVAFAKRIETGMIHVNDTTINDEPNVAFGGEKQSGLGRLNGEWSLEEFTTMKWISVQHEK
RNFPY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaatatgaagaattaaacaaacagtttattgggggaaaatggcgtgagggcgcc
ggttcaagtcttttggaagataagaacccatatacccaaaaaaatatcacatcattccgt
aaagcaaatacggatgacgtagatgaagcatacaagtcagccgcacatgcaaagaaaaaa
tgggacgcggtgaatccgtttgaaaaaagaacgattcttgaaaaagccgtggcttatatt
gaagaaaatgaagaagccattatttatctgattatggaggagctcggcggaacaaggctg
aaagccgcgttcgaaatcggcctagtgaaaaatatcataaaagaagcagcgacatttccg
gtgcggatggaaggcaaaattctcccatccaccattgacggcaaagaaaacagattgtac
agagtgcctgccggtgtggtcggcgttatcagtccgtttaactttcctttcttcctatct
gtgaaatccgtcgcgcccgcgctgggagccggaaatggagtcgtgctgaagccgcatgaa
gaaactccgatttgcggcggtactttgatcgcgaagatttttgaagcggccggcattcct
gaagggcttttgaacgtagtcgtcactgatatcgcagaaatcggcgacagctttgtggag
catcctgtgccgcggattatctcgtttacgggttctacaaaagtgggcagctatatcggc
cagctggcgatgaaacatttcaaaaaacctttgcttgagcttggcggaaacagtgcgctt
atcgtgcttgaagatgctgatcttgaatatgcggtcaatgcggcggtgttcagccggttt
acgcatcaggggcaaatatgtatgtctgcaaaccgcatcttggttcattcttctatccat
gacagatttctggagatgtatcaggcgaaagtggagtcacttaaagtcggagacccgatg
gaccctgaaacgattatcggaccgttaatcaacagcagacaaaccgatgcgttaatgaaa
tctgttgaaaaagcgatagaagaaggagcggttccggttacactcggcggattcgcggga
acagtcgtggagccgacgattttaaaagacgtcaaaccttccatgagcattgcccatgaa
gaattgttcggaccggtggtttcagtgatgaagtttgattcggaagacgaagcggttgat
attgcgaatgatacgccgtttggtttaagcggagcggttcatacggccaatgttgaacgc
ggcgtcgcatttgcgaaacgaattgagaccggaatgatccacgtcaatgatacgacgatc
aacgatgagccgaacgtagccttcggcggagaaaaacaatcaggcctcggccgattaaac
ggcgaatggagccttgaagaatttacaacgatgaaatggatttccgttcagcatgaaaaa
cgcaatttcccatactaa

DBGET integrated database retrieval system