KEGG   Bacillus atrophaeus 1942: BATR1942_02250Help
Entry
BATR1942_02250    CDS       T01339                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bae  Bacillus atrophaeus 1942
Pathway
bae00564  Glycerophospholipid metabolism
bae01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bae00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BATR1942_02250
Enzymes [BR:bae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BATR1942_02250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 GIDA Pyr_redox_2 NAD_binding_8 FAD_oxidored 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ADP31406
UniProt: A0A0H3DX74
LinkDB All DBs
Position
468543..470207
Genome map
AA seq 554 aa AA seqDB search
MNQQFSSLERDNMLSEMTKKTYDLFIIGGGITGAGTALDAASRGMKVALSEMQDFAAGTS
SRSTKLVHGGLRYLKQFEVKMVAEVGKERAIVYENGPHVTTPEWMLLPFHKGGTFGSFST
SIGLRVYDFLAGVKKAERRSMLSSKETLQKEPLVKKDGLKGGGYYVEYRTDDARLTIEVM
KEAVKFGAEPMNYSKVKELLYEKGKVVGVLIEDLLTNKEYKVYAKKVVNATGPWVDQLRE
KDHSKKGKHLQHTKGIHLVFDQSVFPLKQAVYFDTPDGRMVFAIPREGKTYVGTTDTVYK
EALEHPRMTTEDRDYVIKAIQYMFPDLNITENDVESSWAGLRPLIHEEGKDPSEISRKDE
IWTSESGLITIAGGKLTGYRKMAEHIVDLVSNRLKEEGGKDFGSCKTKTMPISGGHVGGS
KNLASFVDAKTKEGVAIGLSEKDAKQLAIRYGSNVENVFKRVEPMKEEAAKRQMPVHILA
EAAYSIEEEMAATPADFFVRRTGRLYFDIHWVETYKHAVIEYMSDRFNWDEQTKNKHTQH
LNELLHDAVVPLDQ
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaacaattttcaagtcttgaacgggataacatgctttcggaaatgacaaaaaag
acatatgatttgtttattataggtggaggaattacaggagcgggcacagcactggacgcc
gcttcaaggggaatgaaagtcgcgctcagcgaaatgcaggacttcgctgcgggaacatca
agcagatcgactaagcttgtccatggaggactgcgttacctcaaacaattcgaagttaaa
atggtcgctgaagtaggaaaagaacgggccatcgtatatgaaaacggcccgcatgtcacc
acacctgaatggatgctgcttccgtttcataaaggcggcacattcggatcattctcaact
tctatcggcttgagagtgtacgactttttagcaggtgtgaaaaaggcggaacgaagaagc
atgctgtcctctaaagaaactctgcaaaaagagcctttggtgaaaaaggacggtctaaaa
ggcggcgggtattacgttgaataccgcacagatgacgcgagattgaccattgaagtaatg
aaagaagccgttaaattcggcgccgagcctatgaactattccaaagttaaagagcttctt
tacgaaaaaggaaaagtagtcggcgtattaattgaagatttactgaccaataaagaatat
aaagtgtatgcgaaaaaagtcgtcaatgcgacgggcccttgggtggaccaattaagagaa
aaggaccattccaaaaaaggtaagcatcttcagcatacgaagggaattcacctagtattt
gaccaatccgtattcccgctaaaacaagcggtttactttgatacgccggacggccgtatg
gtgtttgcgataccaagggaaggcaaaacatatgtaggaacgacggataccgtttataaa
gaagcattagagcatccgcgtatgacgactgaggaccgcgattatgtgataaaagcgatc
caatatatgttcccggatttaaatatcacagagaatgatgtggaatcaagctgggcgggg
cttcgtccgctgattcacgaagaaggaaaagatccttcggaaatttctcgtaaggacgag
atatggacatcagaatcaggtttaatcactatcgccggcggaaagctgaccggctataga
aaaatggctgagcacattgtcgatcttgtaagcaaccgcttaaaagaagaaggcggaaag
gacttcggttcttgtaagacgaaaacaatgccgatctcaggcggacatgtcggcggctct
aaaaatcttgcttccttcgttgatgcaaaaacaaaagaaggcgtcgccatcggtttgtct
gaaaaggatgctaagcagcttgccatcagatacggttctaacgtagagaacgtcttcaaa
agagtcgaaccgatgaaagaagaagctgccaaacgccagatgccggttcatatcttggct
gaagctgcctacagcattgaagaagaaatggcagccacgcctgcagacttttttgtccgc
agaacgggcagattgtactttgacattcattgggtggaaacgtataaacatgctgttatt
gagtatatgagcgaccgtttcaactgggatgagcagacgaaaaacaaacacacacaacat
ctgaatgagctgctgcacgatgccgtcgtgccgcttgatcagtaa

DBGET integrated database retrieval system