KEGG   Bacillus atrophaeus 1942: BATR1942_03505Help
Entry
BATR1942_03505    CDS       T01339                                 

Definition
(GenBank) enoyl-(acyl carrier protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bae  Bacillus atrophaeus 1942
Pathway
bae00061  Fatty acid biosynthesis
bae00780  Biotin metabolism
bae01100  Metabolic pathways
bae01130  Biosynthesis of antibiotics
bae01212  Fatty acid metabolism
Module
bae_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bae00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BATR1942_03505
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BATR1942_03505
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BATR1942_03505
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bae01004]
    BATR1942_03505
Enzymes [BR:bae01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BATR1942_03505
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BATR1942_03505
Lipid biosynthesis proteins [BR:bae01004]
 Fatty acid synthase
  Component type
   BATR1942_03505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: ADP31655
UniProt: A0A0H3DXF8
LinkDB All DBs
Position
713179..713955
Genome map
AA seq 258 aa AA seqDB search
MNFSLEGRNIVVMGVANKRSIAWGIARSLHEAGARLIFTYAGERLEKSVNELAGTLERND
SIILPCDVTNDEEIETCFASIKEQVGVIHGIAHCIAFANKEELVGEYLNTNRDGFLLAHN
ISSYSLTAVVKAARPIMVEGGSIVTLTYLGGELVMPNYNVMGVAKASLDASVKYLAADLG
KENIRVNSISAGPIRTLSAKGISDFNSILKDIEERAPLRRTTTPEEVGDTAAFLFSDMSR
GITGENLHVDSGFHITAR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaatttttcactggaaggccgcaacatcgttgtaatgggagttgccaataaacgcagt
atcgcatggggaatcgcacgttctttacacgaagctggcgcacgactgattttcacttat
gcgggtgaacgcttggagaagtcagtgaatgaattggcagggacattagaacgaaacgat
tcaattatacttccttgtgacgtaacaaacgatgaggaaatcgaaacatgttttgcaagc
attaaagagcaggtcggcgttatccacggtatcgcgcattgtatcgcttttgcgaacaaa
gaagagcttgtcggcgaatatttaaatacgaatcgtgacggcttccttttggcgcataat
atcagctcatattcattgacagctgtcgtcaaagccgctcgtccgatcatggtagaaggc
ggaagcattgtgacattgacttaccttggcggagaacttgttatgccgaattacaacgtt
atgggagtggcgaaagcttctctagacgcaagcgtaaaatatttagctgctgatttaggt
aaagaaaatattcgtgtaaacagtatttcagctggcccgatcagaactttgtctgctaaa
ggcatcagcgacttcaattcaatcttaaaagacatcgaagagcgtgcgccgctccgccgc
acgacaacgcctgaagaggttggagatacagctgcattcttattcagcgatatgtccaga
ggcatcaccggtgaaaaccttcacgttgattcaggtttccatattaccgcacgctaa

DBGET integrated database retrieval system