KEGG   Bacillus atrophaeus 1942: BATR1942_04140Help
Entry
BATR1942_04140    CDS       T01339                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
bae  Bacillus atrophaeus 1942
Pathway
bae00330  Arginine and proline metabolism
bae01100  Metabolic pathways
bae01110  Biosynthesis of secondary metabolites
bae01130  Biosynthesis of antibiotics
bae01230  Biosynthesis of amino acids
Module
bae_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bae00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    BATR1942_04140
Enzymes [BR:bae01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     BATR1942_04140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F420_oxidored P5CR_dimer ApbA NAD_Gly3P_dh_N PDH NAD_binding_2 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ADP31782
UniProt: A0A0H3DZY3
LinkDB All DBs
Position
814195..815013
Genome map
AA seq 272 aa AA seqDB search
MTKIGLIGYGSMADMIAVQLLKHQFIRANELYIDTRSRGERLQKLEADHPDVTIGPLESW
AAECGMVLICVPPVYVKETLRRLTPHINHDAHIVSIAAGVPVAELQAETKNAVSRYIPTL
TSEAETGVSLVVHGETVSSQKKRDLNELLSAFSAVREIKETDLNAASNLTSSAPGLIAAI
FEEFAESAVRNSGLTKEEAFDFLIHSLYGTGKLLTEKNMSFQETLGRVATKGGITGEGAE
VIQSAMPEVFDEVFEKTLKKYKQLTEAVKGQM
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaatcggtttaatcggatacggcagtatggcggatatgattgctgttcagtta
ttgaagcatcaattcatccgcgcaaacgaactttatattgatacaaggtcaagaggagag
cgtcttcaaaaattggaagcagaccatccggacgttacaattggtcctcttgagtcttgg
gctgcggagtgcgggatggttttgatatgtgtgccgcctgtttatgtaaaggaaacattg
cgccgtctgacgcctcatatcaatcatgacgcccacattgtttctattgcggcaggtgtg
ccggtagccgagctgcaagccgaaacgaaaaacgcggtcagccgatatattccgacatta
acctcggaagcagagacaggtgtatcgcttgttgtccacggcgaaacggtgtcttctcaa
aagaaaagagatctgaatgagttattatcagctttcagcgcagtgagggaaatcaaggaa
actgatctgaacgcggcaagcaatttaacaagctctgcgccggggctgattgcggcaata
tttgaggaattcgcagagtccgcggtaagaaacagcgggctgacaaaagaggaagctttt
gattttctgattcattcgctttatggaacagggaagctgttgacggaaaagaacatgtct
tttcaggaaaccctcggccgcgtcgccacaaaaggcggcattacgggagaaggcgccgaa
gtcatccagtcagccatgccagaggtgttcgacgaggtatttgagaaaacgctgaaaaaa
tataaacagctgacagaagcggttaaaggccaaatgtga

DBGET integrated database retrieval system