KEGG   Bacillus atrophaeus 1942: BATR1942_14335Help
Entry
BATR1942_14335    CDS       T01339                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
bae  Bacillus atrophaeus 1942
Pathway
bae00071  Fatty acid degradation
bae00280  Valine, leucine and isoleucine degradation
bae00281  Geraniol degradation
bae00362  Benzoate degradation
bae00592  alpha-Linolenic acid metabolism
bae01100  Metabolic pathways
bae01110  Biosynthesis of secondary metabolites
bae01120  Microbial metabolism in diverse environments
bae01130  Biosynthesis of antibiotics
bae01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bae00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BATR1942_14335
   00592 alpha-Linolenic acid metabolism
    BATR1942_14335
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BATR1942_14335
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    BATR1942_14335
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BATR1942_14335
   00642 Ethylbenzene degradation
    BATR1942_14335
Enzymes [BR:bae01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     BATR1942_14335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ADP33789
UniProt: A0A0H3E5Z2
LinkDB All DBs
Position
complement(2805864..2807039)
Genome map
AA seq 391 aa AA seqDB search
MREAVIVAGARTPVGKAKKGSLATVRPDDLGAICVKETLRRAGGYEGNIDDLIIGCAMPE
AEQGLNMARNIGALAGLPHTVPAITVNRYCSSGLQSIAYGAEKIMLGAYDTAIAGGAESM
SLVPMMGHVTRPNITLAENAPEYYMSMGHTAEQVAKTYGVSRDDQDAFAARSHQKAAKAI
SEGKFQDEIVPVEVKVTQIGPDHKPSEKSFTFSQDEGVRPQTNTDILSSLRPAFAMDGTV
TAGNSSQTSDGAAAVMLMDREKADALGLSPLVKFRSFAVGGVPPEVMGIGPVEAIPRALK
LAGLELSDIGLFELNEAFASQSIQVMRQLGIDEEKVNVNGGAIALGHPLGCTGTKLTLSL
IHEMKRRNEQFGVVTMCIGGGMGAAGVFELL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagagaggcagtcattgtggcaggagcgagaactccggtcggcaaagcgaaaaaggga
tcattggcaacagtccgtccggatgatttgggagctatttgtgtgaaagaaacattaaga
agagcaggcggttatgaaggcaatattgatgacctcattattggatgcgccatgccggaa
gccgaacagggattaaatatggcaagaaacatcggcgcgcttgcgggtcttccgcatacg
gtgccggcaattacagtcaaccgctactgctcttcgggcttgcaatctatcgcctatggg
gctgaaaaaattatgctcggcgcatatgatacggcaatcgccggcggcgcggagtcaatg
tcattggttccgatgatggggcatgtaacacgcccgaacatcacgctggctgaaaatgcg
ccagagtattacatgagcatgggacataccgccgagcaggtagcgaaaacatacggcgtt
tcccgcgatgatcaggatgcatttgctgcacgcagtcaccaaaaagcggcaaaagccatt
tcggaaggcaaattccaagatgaaattgtgcctgtcgaagtgaaagtgacacaaatcggg
cctgaccataagccaagtgaaaaaagctttacgttttcccaagatgaaggcgtgcgtccg
caaacgaacacggacattttatcatcgctgcgtccggcgtttgctatggacggaaccgtc
acggcgggaaactcgtcacaaacaagtgacggcgcggcggctgtgatgctgatggacagg
gaaaaagcagatgctttggggctttctccgctggtgaagttccgttcatttgcagtaggc
ggcgttccgccggaggttatgggaatcgggcctgtggaagccattccacgcgcactcaag
cttgccggactggaattgagcgacatcggtttgtttgaattgaacgaagcctttgcctca
cagtccattcaagtcatgaggcaactcggaatagacgaagaaaaagtaaacgttaatgga
ggcgcgattgcgcttggacacccgctaggctgtacaggcacaaagctgaccctgtcactc
attcacgaaatgaaacgaagaaatgaacaattcggcgtggtcacaatgtgtatcggcggc
ggtatgggagcagcaggcgtatttgaattactttaa

DBGET integrated database retrieval system