KEGG   Bacillus atrophaeus 1942: BATR1942_14360Help
Entry
BATR1942_14360    CDS       T01339                                 

Definition
(GenBank) hypothetical protein
Organism
bae  Bacillus atrophaeus 1942
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Coat_F Autoind_synth
Motif
Other DBs
NCBI-ProteinID: ADP33794
UniProt: A0A0H3E5Z5
LinkDB All DBs
Position
2811071..2811403
Genome map
AA seq 110 aa AA seqDB search
MNQQNQQKISNPETPVPATSQMNDRDFVNELLTTEKYITSSYCTALHEFSHESLYQDIQS
IFDESQKAQRKLYDLMFQYGWYSIEAEDAQKLQQSHQKFQQTLQQQSPYQ
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagcaaaatcagcaaaaaatcagcaacccggaaacaccagtgccggcgacttct
caaatgaatgacagagatttcgtcaatgagctgctgacaacagaaaaatatatcacttct
tcttattgcacagccttgcacgaattcagccatgagtctctctatcaggatattcaatcc
atttttgatgagtcacaaaaagcgcaaagaaaactttatgatctcatgttccagtatggg
tggtactctatagaggcggaggatgcgcaaaagctgcagcagtcccatcaaaaattccag
caaacccttcaacagcaatcgccttatcagtaa

DBGET integrated database retrieval system