KEGG   Bacillus atrophaeus 1942: BATR1942_15320Help
Entry
BATR1942_15320    CDS       T01339                                 

Definition
(GenBank) hypothetical protein
Organism
bae  Bacillus atrophaeus 1942
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADP33983
UniProt: A0A0H3E6K4
LinkDB All DBs
Position
complement(3003304..3003591)
Genome map
AA seq 95 aa AA seqDB search
MKDKASRINEPINDILHLTKQFESPLKDEIKGQKGLIIDKIKEEIDSKSEKRQSALTTIK
EENIIKVSLYKSIIEDLRVQDVTLYYKKKKPEEGF
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacaaagctagccggattaatgaaccgatcaatgatatcctgcacctgacaaag
caatttgaatccccattaaaggatgaaatcaaggggcaaaaagggttgattattgacaaa
atcaaagaagaaattgattcaaaaagcgaaaaacggcaatctgcacttacaaccataaaa
gaagaaaatatcattaaagtgagtctttataaaagcattattgaagatctaagagtgcaa
gatgtgacgctttattataaaaaaaagaagcctgaagagggcttttag

DBGET integrated database retrieval system