KEGG   Bacillus atrophaeus 1942: BATR1942_15335Help
Entry
BATR1942_15335    CDS       T01339                                 

Definition
(GenBank) bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase protein
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
bae  Bacillus atrophaeus 1942
Pathway
bae00340  Histidine metabolism
bae01100  Metabolic pathways
bae01110  Biosynthesis of secondary metabolites
bae01230  Biosynthesis of amino acids
Module
bae_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bae00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BATR1942_15335
Enzymes [BR:bae01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     BATR1942_15335
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     BATR1942_15335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: ADP33986
UniProt: A0A0H3E455
LinkDB All DBs
Position
complement(3004667..3005293)
Genome map
AA seq 208 aa AA seqDB search
MKRADELTFNEDGLIPAIVQDAASKEILTLAYMNQESYEKTLETKETWFYSRSRQELWRK
GETSGHTQAVKGIRYDCDQDALIVLVEPAGPACHKGSYSCFTSEQGEEKTGGRFSILNEL
ERVIAEREAEMPEGAYTTYLFREGVDKILKKVGEEASEVIIAAKNRDHEELKWEAADLLY
HLLVLLREQSLPLDDVLEVLQKRHSESE
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgggcagatgaattaacatttaacgaggatggactcatccctgccattgtgcag
gatgctgcaagcaaggaaattctgacgctggcgtatatgaatcaagaatcctacgaaaaa
acattggaaacgaaagaaacatggttttacagccgatcacgccaagaattatggcgcaag
ggagagacgtccggacatacacaagccgtaaagggcattcgctatgactgcgatcaggac
gcccttatcgtgcttgtggagccggccggcccggcgtgccataaaggaagctacagttgc
ttcacttctgagcaaggtgaggaaaagacaggcggccgcttcagcattctcaatgaactg
gagcgcgtcatcgcggaacgtgaagcggaaatgcctgagggagcgtatacaacatacctc
ttccgtgagggtgttgataaaatattaaaaaaagtaggagaagaagcatccgaagttatc
atcgcagccaaaaaccgggatcacgaagaattgaaatgggaagcggctgacctgctgtat
cacctgctcgttcttctgcgtgaacaatcgctcccgctggatgatgtgctcgaggttttg
cagaaacgccattcggagtctgaataa

DBGET integrated database retrieval system