KEGG   Bacillus atrophaeus 1942: BATR1942_15650Help
Entry
BATR1942_15650    CDS       T01339                                 

Definition
(GenBank) hypothetical protein
Organism
bae  Bacillus atrophaeus 1942
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0029 DUF1949
Motif
Other DBs
NCBI-ProteinID: ADP34049
UniProt: A0A0H3E6N7
LinkDB All DBs
Position
3064623..3065276
Genome map
AA seq 217 aa AA seqDB search
MLHSYLTVKEAGEHEIVIEKSRFICHLSRVSSEKEAQEFIQDIKKQHWNATHNCSAYMIG
ETDHIQKANDDGEPSGTAGVPMLEVLKKRGLKDTCAVVTRYFGGIKLGAGGLIRAYGKSV
SEGLNHIGVVERKLMRIMHTSVDYTWLGKVENELRESPYQLKEIHYAEHVEFETYVEEKE
KQAFSEWITDLTNGKGDNTEGDLTYLEKVVNHLKETE
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgctgcacagctatttaactgtgaaagaagcaggtgaacacgaaattgtgattgaaaaa
tcacggtttatctgccatttaagccgtgtttcttctgaaaaagaggcacaggaatttatt
caggatataaagaaacagcactggaatgccacccataactgttctgcttatatgattggc
gaaaccgatcatatccaaaaagcgaatgacgacggagagccaagcggcacagccggcgtg
cctatgcttgaggtattgaaaaaacgcggactcaaggatacttgcgctgttgtaacacgg
tacttcggaggaattaagcttggtgcgggcggactgattcgcgcttatggaaagtcagtg
tctgagggtttaaatcatataggagtcgttgagcggaagctgatgaggatcatgcatact
tctgtcgattacacatggctcggaaaagtagaaaatgaattaagagaatcgccttatcag
ctaaaagaaatccattatgcggaacatgtcgaatttgagacatatgtagaagagaaagag
aaacaagccttctctgaatggattacggatttaacaaatggaaaaggtgataatacagaa
ggagatttgacgtatcttgaaaaagtcgtcaaccatctaaaggagacagaataa

DBGET integrated database retrieval system