KEGG   Bacillus atrophaeus 1942: BATR1942_19175Help
Entry
BATR1942_19175    CDS       T01339                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bae  Bacillus atrophaeus 1942
Brite
KEGG Orthology (KO) [BR:bae00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bae03012]
    BATR1942_19175
   03029 Mitochondrial biogenesis [BR:bae03029]
    BATR1942_19175
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bae04147]
    BATR1942_19175
Translation factors [BR:bae03012]
 Eukaryotic Type
  Elongation factors
   BATR1942_19175
 Prokaryotic Type
   BATR1942_19175
Mitochondrial biogenesis [BR:bae03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BATR1942_19175
Exosome [BR:bae04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BATR1942_19175
  Exosomal proteins of breast cancer cells
   BATR1942_19175
  Exosomal proteins of colorectal cancer cells
   BATR1942_19175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW DLIC RsgA_GTPase Peptidase_U32_C
Motif
Other DBs
NCBI-ProteinID: ADP34752
UniProt: A0A0H3E650
LinkDB All DBs
Position
3755769..3756959
Genome map
AA seq 396 aa AA seqDB search
MAKEKFDRSKSHANIGTIGHVDHGKTTLTAAISTVLHKKSGKGTAMAYDQIDGAPEERER
GITISTAHVEYETDTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREH
ILLSKNVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYDFPGDDVPVVKGSALKAL
EGDAEYEEKILELMAAVDEYIPTPERDTEKPFMMPVEDVFSITGRGTVATGRVERGQVKV
GDEVEIIGLQEENSKTTVTGVEMFRKLLDYAEAGDNIGALLRGVAREDIQRGQVLAKPGT
ITPHSKFKAEVYVLSKEEGGRHTPFFSNYRPQFYFRTTDVTGIIQLPEGVEMVMPGDNTE
MIVELISTIAIEEGTRFSIREGGRTVGSGVVSTITE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaaaattcgaccgttccaaatcacatgccaatattggtacaattggacac
gttgaccatggtaaaacaacattaactgctgctatctcaacagtacttcataagaaatct
ggtaaaggtacagctatggcgtacgatcaaattgatggtgctccagaagaacgcgagcgc
ggtatcactatctctactgcacacgttgagtacgaaactgacacacgtcactatgcacac
gttgactgcccaggacacgctgactatgttaaaaacatgatcactggtgctgcgcaaatg
gacggagctatccttgtagtatctgctgctgatggcccaatgccacaaactcgtgagcac
atccttctttctaaaaacgttggtgtaccttacatcgttgtattcttaaacaaatgcgac
atggtagacgacgaagagcttcttgaactagttgaaatggaagttcgcgatcttcttagc
gaatacgatttccctggcgatgatgttcctgttgttaaaggttctgctcttaaagctctt
gaaggagacgctgagtacgaagaaaaaattcttgagcttatggctgcggttgatgagtac
atcccaactccagaacgcgacactgaaaaaccattcatgatgcctgttgaggacgttttc
tcaatcacaggtcgtggaacagttgctactggacgtgtagaacgcggacaagttaaagtc
ggtgacgaagttgaaatcatcggtcttcaagaagaaaacagcaaaacaactgttactggt
gttgaaatgttccgtaagcttcttgattacgctgaagctggagacaacattggagcactt
cttcgcggtgtagctcgtgaagatatccaacgtggtcaagtacttgctaaaccaggtaca
atcactccacacagcaaattcaaagctgaagtttatgttctttcaaaagaagagggtgga
cgtcatactccattcttctctaactaccgtcctcagttctacttccgtacaactgatgta
actggtatcatccaacttccagaaggcgtagaaatggttatgcctggagacaacactgaa
atgatcgttgagcttatctcaactatcgctatcgaagaaggaactcgtttctctattcgt
gaaggcggacgtactgttggctctggtgttgtttctacaatcactgagtaa

DBGET integrated database retrieval system