KEGG   Bacillus atrophaeus 1942: BATR1942_19880Help
Entry
BATR1942_19880    CDS       T01339                                 

Definition
(GenBank) 2,5-dioxovalerate dehydrogenase (alpha-ketoglutaric semialdehyde dehydrogenase)
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
bae  Bacillus atrophaeus 1942
Pathway
bae00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:bae00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BATR1942_19880
Enzymes [BR:bae01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BATR1942_19880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ADP34891
UniProt: A0A0H3E6Q3
LinkDB All DBs
Position
3898838..3900304
Genome map
AA seq 488 aa AA seqDB search
MSVMTEKNTYLNYINGAWVKSHSGDMVKVENPADIHDLVGYVQNSTAEDVDRAVAAANEA
KAAWRKLSGAERGQYLYKTADIMEQRLDEIAACATREMGKTLPEAKGETARGIAILRYYA
GEGMRKTGDVIPSTDKDALMFTTRVPLGVVGVISPWNFPVAIPIWKMAPALVYGNTVVIK
PATETAITCAKIIACFEEAGLPAGVINLVTGPGSVVGQGLAEHNGVNGITFTGSNQVGKI
IGQAALERGAKYQLEMGGKNPIIVTNEADLDAAAEAAITGAFRSTGQKCTATSRVIVQSK
VYDRFKEKLIQRTKDITIGNSLKEDVWMGPIASKNQLDHCLSYIEKGIQEGASLLIGGEK
LEAGDYQNGYYVQPAIFDNVTSDMTIAQEEIFGPVIALLKVGTMEEALDIANDVKFGLSA
SLFTQNIGHMLSFIDDIEAGLVRVNAESAGVELQAPFGGLKQSSSHSREQGEAAKDFFTA
IKTVFIKQ
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgatgacggaaaaaaacacataccttaattatattaatggagcgtgggtcaaa
tcccattcaggcgatatggtaaaggtcgaaaatccggctgatatccatgatcttgtgggc
tatgtgcaaaactcgacggctgaagatgtggaccgggccgtagcggctgcaaatgaagcg
aaagcggcatggagaaagctgtctggcgctgagcggggccaatacttgtacaaaacggct
gatatcatggaacagcgtctggatgaaattgcagcctgcgctacacgcgagatgggtaaa
acactgccggaagcaaaaggggaaaccgccagagggattgccattcttcgatattacgcc
ggagaaggcatgcgcaaaacaggcgatgttatcccgtctactgacaaagatgcgctgatg
tttacaacccgtgttcctctcggggtggtcggcgttatttctccatggaacttcccggtc
gcaatcccgatttggaaaatggctccggcattggtgtacggcaataccgttgtcattaaa
ccagcgacagaaacagctattacctgtgcgaaaatcatcgcatgctttgaagaagcgggg
cttccggcgggcgttatcaatttggtgacaggcccggggtcagtcgtcggccaaggactt
gccgagcataatggagtgaacggcatcacattcaccggatcgaaccaggttggtaaaatc
atcgggcaagccgctttagaacggggagccaagtaccagcttgaaatgggcgggaaaaac
ccgatcatcgtaacaaatgaagccgatcttgatgccgccgctgaagcagcgattaccggc
gcattccgttcgaccggccaaaagtgcacagccaccagccgtgtcattgtacaaagtaag
gtttacgacagattcaaagaaaaattaatacagcgcacaaaagacattaccatcggtaac
agcttaaaagaagacgtatggatgggaccgatcgcaagcaagaatcagcttgatcattgc
ctttcctatatcgaaaaaggaatacaagagggcgcttcccttttgatcgggggagaaaag
ctggaggctggagactatcaaaatggttactatgttcagcccgcaatttttgacaacgtc
acctctgacatgaccattgcccaggaagagattttcggaccggtcatcgccttattgaag
gtcggcacaatggaagaggctttagatatcgccaatgatgtgaagtttggactaagtgct
tcgcttttcacccaaaacatcggccatatgctgtcttttatagatgatattgaagcagga
cttgttcgggtcaacgcagaaagcgcaggggttgaacttcaggctccttttggcggtctc
aaacaatcaagctctcactctcgcgaacagggcgaggcggctaaagactttttcacggcg
attaaaaccgtttttattaaacagtaa

DBGET integrated database retrieval system