KEGG   Bacillus atrophaeus 1942: BATR1942_21060Help
Entry
BATR1942_21060    CDS       T01339                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bae  Bacillus atrophaeus 1942
Pathway
bae00473  D-Alanine metabolism
bae01100  Metabolic pathways
bae01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bae00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BATR1942_21060
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BATR1942_21060
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bae01011]
    BATR1942_21060
Enzymes [BR:bae01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BATR1942_21060
Peptidoglycan biosynthesis and degradation proteins [BR:bae01011]
 Precursor biosynthesis
  Racemase
   BATR1942_21060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ADP35127
UniProt: A0A0H3E767
LinkDB All DBs
Position
4154133..4155302
Genome map
AA seq 389 aa AA seqDB search
MNIKPFYRDTWAEINLSAIEENVSNMKKHIGDRVELMAVVKANAYGHGDAEVAEAALSAG
ASCLAVAILDEAISLRKRGLAAPILVLGAVPPEYVEIAAEYDVTLTGYSVEWIQEAARHI
KETPVHFHLKVDTGMNRLGVKTEEEVQNVMKILERNPGLLCKGVFTHFATADEKDRSYFL
MQFERFKELIAPLPWKQLMVHCANSAAGLRLKKGFFNAVRFGVGMYGLRPSAEITNEIPF
RLHQAFTLNSTLTHVKKIHKGESVSYGATYTAEKDQWIGTVPVGYADGWLRKLQGTEVLI
NGKRLKIAGRICMDQFMVELDKEYPPGSRVTLIGRQKDDCITVDEIASRLETINYEVTCT
ISSRVPRMFLKNGSIMEVRNPLLQENASK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaacataaaaccgttttacagagatacgtgggcagaaattaacttgtctgcgatagaa
gaaaatgtaagcaatatgaaaaagcatatcggtgaccgcgttgagctaatggcggtagtg
aaggcaaacgcctacggccatggtgatgcggaagtggcggaagcggcattgtccgcaggt
gcttcatgcctcgctgttgccattttggatgaagcgatatcattgcgaaaacgcggcctg
gccgcgcctattttagtgcttggagccgttccgccggaatatgtggagatagcggctgaa
tatgacgttacgctgacaggctactcagtcgaatggatacaggaagctgcccgccacata
aaagagacccccgtccactttcatcttaaagtagatacgggaatgaacagactcggcgtc
aaaacagaagaagaagtccaaaacgtgatgaaaattctggagcgcaatcccggcttacta
tgcaaaggcgtttttactcattttgcaacagctgatgaaaaagacagaagctatttcctc
atgcagtttgaacgatttaaagagctgattgctccgcttccgtggaagcagctcatggtt
cactgcgcaaatagcgccgccggtctgcgtctgaaaaaaggcttttttaacgcggtccga
ttcggagtcggcatgtacgggcttcgtccgtccgctgaaataacaaacgagattccgttc
cggctacaccaggcattcaccctgaactccactttgacccatgtgaaaaaaatacacaaa
ggggagagtgtcagctatggcgcgacatatacggctgaaaaagaccaatggatcggcacg
gtgccggtcggttacgcggacgggtggctgcgaaaactgcaaggcactgaggttctcata
aacggcaaaaggctcaaaattgcaggaagaatctgcatggatcaatttatggttgaactg
gataaagagtatcccccgggatccagagtcactttgatcggcagacaaaaggacgactgc
ataaccgttgatgaaatcgccagccggctggaaacgattaactatgaagtgacatgtaca
ataagttcccgcgttccccgtatgtttttgaaaaatgggagtataatggaagtaagaaat
cctttattgcaggaaaatgcaagcaaatag

DBGET integrated database retrieval system