KEGG   Borrelia afzelii (FLI): BAPKO_0800Help
Entry
BAPKO_0800        CDS       T00383                                 

Definition
(GenBank) hypothetical protein
  KO
K00784  ribonuclease Z [EC:3.1.26.11]
Organism
baf  Borrelia afzelii (FLI)
Brite
KEGG Orthology (KO) [BR:baf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:baf03016]
    BAPKO_0800
Enzymes [BR:baf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.11  tRNase Z
     BAPKO_0800
Transfer RNA biogenesis [BR:baf03016]
 Eukaryotic type
  3'processing and CCA adding factors
   3'processing factors
    BAPKO_0800
 Prokaryotic type
    BAPKO_0800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactamase_B_2 Lactamase_B Lactamase_B_4 Lactamase_B_3
Motif
Other DBs
NCBI-ProteinID: ABH02026
UniProt: Q0SMA2
LinkDB All DBs
Position
complement(801546..802505)
Genome map
AA seq 319 aa AA seqDB search
MGFNINIIGTGGTRPLHNRYLSSVLIEYNGDNFLFDCGEGTQMSLRKQKISWQKIKMICI
THLHADHITGLLGIVMLMSQSGETRKDPLIIAGPVGIKNYTKNNIDMLKIYTNYEIIYKE
IIIDKTEKIIYEDKTKKIEYTRLKHSIECVGYLFIEKDKPGKFNTEKAEELNIPKGPIRK
TLQDGKEILINGKIIKPSEILGKSKKGLKVAYITDTGYFKELIQQIKNFNLVIIESTFKN
ELKKEADKKLHLTAGGAANIVKQAKVLQTGLIHFSERYTLRKDLENLLKEAKLEYPDGEI
FLTKDGMRLEANKNNFIIK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
ttgggattcaatattaacattataggaactgggggaacaaggccactccataacagatat
ttgtcatccgtactaatcgaatacaatggagacaattttttattcgattgtggagaagga
actcaaatgtctttaagaaaacaaaaaatatcttggcaaaaaataaaaatgatttgtatt
acgcacttacatgctgatcacattacaggactacttggaatagtaatgctaatgtcacaa
agtggagaaacaagaaaagatccattaataattgctggacctgttggaataaaaaactat
acaaaaaataacatagacatgcttaaaatatatacaaactatgaaataatttataaagaa
ataatcatagataaaaccgaaaaaataatatatgaagataaaacaaaaaaaattgaatat
accagactaaaacattcaatagaatgtgttggatatttattcatagaaaaagataaacct
ggtaaattcaatacagaaaaagcagaagagttaaatatccctaaaggacctattagaaaa
accctgcaagatggaaaagaaatattaataaacggaaaaattataaagccatcagaaata
cttggaaaatctaaaaaaggattaaaagttgcttacattacagatactggttattttaaa
gaactcatacagcaaatcaaaaacttcaaccttgtaataattgagagcacatttaaaaat
gagcttaaaaaggaagcagataaaaaacttcacttaacagctggtggagccgcaaatatt
gtcaagcaagcaaaggttttacaaacgggacttattcattttagcgaaagatatacatta
agaaaagatcttgaaaacttactaaaggaggcaaaattggaatatccggacggagaaatt
tttttaacaaaagatggaatgagacttgaagcaaacaaaaataactttattattaaatag

DBGET integrated database retrieval system