KEGG   Borreliella afzelii K78: BAFK78_238Help
Entry
BAFK78_238        CDS       T03895                                 

Gene name
glpA
Definition
(GenBank) glycerol-3-phosphate dehydrogenase, anaerobic
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bafe  Borreliella afzelii K78
Pathway
bafe00564  Glycerophospholipid metabolism
bafe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bafe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BAFK78_238 (glpA)
Enzymes [BR:bafe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BAFK78_238 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like Pyr_redox_2 Pyr_redox_3 NAD_binding_8 MatB FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AJY72234
LinkDB All DBs
Position
247823..249412
Genome map
AA seq 529 aa AA seqDB search
MEEYLNFMNNNKEAKLKDLENQEFDLIIIGGGATGLGIAVDAITRGYKAILIEKFDYAKG
TSSRSSKLIHGGVRYLAQWNISLVKEALHEKAVLEKNAPHLINECAFITPIYNILEIPYY
YFGLTYYHNLMGKEKATKYKTKLLSKTSTIEKAPNIKAEGLKCSVLYYDDSFDDARMAIT
LLRTFTEKGGIALNYTELKKFNKENGKLSGVVIQNKSSKEQISLKSKCIINATGIFSDEI
RKLDDEKALNIIKPSQGSHLIIKKDKFPKNHAILIPKTSDNRILFAIPWYDGVVCGSTDI
PIKEIEVEPKRFDEEVDFIINNLNNYLNIKIEKSDIKSVYTGIRPLIMDPKAEGNTSKIS
RNEKIFISDSNLITIAGGKYTTYRKMAEKTLLKAIEKNLIPNYPATTEDLKLHGYLKKEE
AIKIPEPFRAYGSDFEILKNMEGFDKKIHENLDLNEAQIAFSIEFEQAKTIDDVLARRTR
SLPLNPQAAIEAAPRVAEIMMKKLNKSEEWKNEEIKNFLELSKKYLINN
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggaggaatatttgaatttcatgaataataacaaagaagcaaaattaaaagatcttgaa
aatcaagaatttgatcttataataattggaggaggcgcaacaggtcttggtattgcagta
gacgcaatcacaaggggatataaagcaatacttatagaaaaatttgattacgcaaaagga
acttcctctagatcaagcaaattaattcacggtggagtaagatatttagctcaatggaat
atttctttggttaaagaagccttacacgaaaaagccgttcttgaaaaaaatgcaccccat
ttaattaatgaatgcgcatttattactcctatttataacatattagaaataccttattat
tattttgggctaacttattaccacaatcttatgggtaaagaaaaagctaccaaatacaaa
actaaattactatccaaaacatctaccattgaaaaagctcctaatattaaagcagagggt
cttaaatgctctgttctatattacgatgattcattcgatgatgctaggatggcaataaca
ttattgagaacttttactgaaaaagggggtattgccctcaactacacggagcttaaaaaa
ttcaacaaggaaaacggaaaactttcaggggttgtcatacaaaataaatcgtcaaaagag
caaatttcattaaaaagcaaatgtataataaacgcaacaggaatattttcagatgaaata
agaaaattagacgatgaaaaagctttaaacattatcaaaccttcccaaggtagtcattta
ataatcaaaaaagacaaattccctaaaaatcatgcaatattaatacctaaaactagcgat
aatagaattttatttgctattccttggtatgatggtgttgtttgtggaagcaccgacatt
ccaataaaagagatagaagtagaacccaaaagatttgatgaagaggttgactttataatt
aataatttaaataactatttaaatattaaaatagaaaaatcagatataaaaagcgtatat
actggaataagaccattaataatggatccaaaagctgaaggcaacacttcaaaaatttca
agaaatgaaaaaatatttatatcagattcaaatcttattacaatagcaggggggaaatat
actacatatagaaaaatggcagaaaaaaccttgctcaaggccatagaaaaaaatttaata
ccaaattatccagcaactacagaagatttaaagttacacggctatcttaaaaaagaagag
gcaataaaaattcctgaaccttttagagcttatggtagtgactttgaaattctaaaaaat
atggaagggtttgacaaaaagatacacgaaaacttagatttaaatgaggctcaaatagct
ttttcaattgaatttgagcaagccaaaactattgatgatgttttagcaagaagaacaaga
tcgttacctttaaatccccaagctgcaattgaagctgctccaagagttgctgaaataatg
atgaaaaaattaaataaatctgaagagtggaaaaatgaagaaataaaaaactttttagaa
ttaagtaaaaaatacttaattaataattaa

DBGET integrated database retrieval system