KEGG   Borrelia afzelii HLJ01: BafHLJ01_0262Help
Entry
BafHLJ01_0262     CDS       T02298                                 

Gene name
glpA
Definition
(GenBank) glycerol-3-phosphate dehydrogenase, anaerobic
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bafh  Borrelia afzelii HLJ01
Pathway
bafh00564  Glycerophospholipid metabolism
bafh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bafh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BafHLJ01_0262 (glpA)
Enzymes [BR:bafh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BafHLJ01_0262 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like Pyr_redox_2 Pyr_redox_3 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AFU74524
LinkDB All DBs
Position
247197..248765
Genome map
AA seq 522 aa AA seqDB search
MNNNKEAKLKDLENQEFDLIIIGGGATGLGIAVDAITRGYKAILIEKFDYAKGTSSRSSK
LIHGGVRYLAQWNISLVKEALHEKAVLEKNAPHLINECAFITPIYNILEIPYYYFGLTYY
HNLMGKEKATKYKTKLLSKTSTIEKAPNIKAEGLKCSVLYYDDSFDDARMAITLLRTFTE
KGGIALNYTELKKFNKENGKLSGVVIQNKLSKEQISLKSKCIINATGIFSDEIRKLDDEK
ALNIIKPSQGSHLIIKKDKFPKNHAILIPKTSDNRILFAIPWYDSVVCGSTDIPIKEIEV
EPKRFDEEVDFIINNLNNYLNIKIEKSDIKSVYTGIRPLIMDPKAEGNTSKISRNEKIFI
SDSNLITIAGGKYTTYRKMAEKTLLKAIEKNLIPNYPATTEDLKLHGYLKKEEAIKIPEP
FRAYGSDFEILKNMEGFDKKIHENLDLNEAQIAFSIEFEQAKTIDDVLARRTRSLPLNPQ
AAIEAAPRVAEIMMKKLNKSEEWKNEEIKNFLELSKKYLINS
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgaataataacaaagaagcaaaattaaaagatcttgaaaatcaagaatttgatcttata
ataattggaggaggcgcaacaggtcttggtattgcagtagacgcaatcacaaggggatat
aaagcaatacttatagaaaaatttgattacgcaaaaggaacttcctctagatcaagcaaa
ttaattcacggtggagtaagatatttagctcaatggaatatttctttggttaaagaagcc
ttacacgaaaaagccgttcttgaaaaaaatgcaccccatttaattaatgaatgcgcattt
attactcctatttataacatattagaaataccttattattattttgggctaacttattac
cacaatcttatgggtaaagaaaaagctaccaaatacaaaactaaattactatccaaaaca
tctaccattgaaaaagctcctaatattaaagcagagggtcttaaatgctctgttctatat
tacgatgattcattcgatgatgctaggatggcaataacattattgagaacttttactgaa
aaagggggtattgccctcaactacacggagcttaaaaaattcaacaaggaaaacggaaaa
ctttcaggggttgtcatacaaaataaattgtcaaaagagcaaatttcattaaaaagcaaa
tgtataataaacgcaacaggaatattttcagatgaaataagaaaattagacgatgaaaaa
gctttaaacattatcaaaccttcccaaggtagtcatttaataatcaaaaaagacaaattc
cctaaaaatcatgcaatattaatacctaaaactagcgataatagaattttatttgctatt
ccttggtatgatagtgttgtttgtggaagcaccgacattccaataaaagagatagaagta
gaacccaaaagatttgatgaagaggttgactttataattaataatttaaataactattta
aatattaaaatagaaaaatcagatataaaaagcgtatatactggaataagaccattaata
atggatccaaaagctgagggcaacacttcaaaaatttcaagaaatgaaaaaatatttata
tcagattcaaatcttattacaatagcagggggaaaatatactacatatagaaaaatggca
gaaaaaaccttgctcaaggccatagaaaaaaatttaataccaaattatccagcaactaca
gaagatttaaagttacacggctatcttaaaaaagaagaggcaataaaaattcctgaacct
tttagagcttatggtagtgactttgaaattctaaaaaatatggaagggtttgacaaaaag
atacacgaaaacttagatttaaatgaagctcaaatagctttttcaattgaatttgagcaa
gccaaaactattgatgatgttttagcaagaagaacaagatcgttacctttaaatccccaa
gctgcaattgaagctgctccaagagttgctgaaataatgatgaaaaaattaaataaatct
gaagagtggaaaaatgaagaaataaaaaactttttagaattaagtaaaaaatacttaatt
aatagttaa

DBGET integrated database retrieval system