KEGG   Borreliella afzelii Tom3107: P612_01215Help
Entry
P612_01215        CDS       T03256                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
baft  Borreliella afzelii Tom3107
Pathway
baft00564  Glycerophospholipid metabolism
baft01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:baft00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    P612_01215
Enzymes [BR:baft01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     P612_01215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like Pyr_redox_2 Pyr_redox_3 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AIK18549
LinkDB All DBs
Position
247653..249242
Genome map
AA seq 529 aa AA seqDB search
MEEYLNFMNNNKEAKLKDLENQEFDLIIIGGGATGLGIAVDAITRGYKAILIEKFDYAKG
TSSRSSKLIHGGVRYLAQWNISLVKEALHEKAVLEKNAPHLINECAFITPIYNILEIPYY
YFGLTYYHNLMGKEKATKYKTKLLSKTSTIEKAPNIKAEGLKCSVLYYDDSFDDARMAIT
LLRTFTEKGGIALNYTELKKFNKENGKLSGVVIQNKLSKEQISLKSKCIINATGIFSDEI
RKLDDEKALNIIKPSQGSHLIIKKDKFPKNHAILIPKTSDNRILFAIPWYDSVVCGSTDI
PIKEIEVEPKRFDEEVDFIINNLNNYLNIKIEKSDIKSVYTGIRPLIMDPKAEGNTSKIS
RNEKIFISDSNLITIAGGKYTTYRKMAEKTLLKAIEKNLIPNYPATTEDLKLHGYLKKEE
AIKIPEPFRAYGSDFEILKNMEGFDKKIHENLDLNEAQIAFSIEFEQAKTIDDVLARRTR
SLPLNPQAAIEAAPRVAEIMMKKLNKSEEWKNEEIKNFLELSKKYLINN
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggaggaatatttgaatttcatgaataataacaaagaagcaaaattaaaagatcttgaa
aatcaagaatttgatcttataataattggaggaggcgcaacaggtcttggtattgcagta
gacgcaatcacaaggggatataaagcaatacttatagaaaaatttgattacgcaaaagga
acttcctctagatcaagcaaattaattcacggtggagtaagatatttagctcaatggaat
atttctttggttaaagaagccttacacgaaaaagccgttcttgaaaaaaatgcaccccat
ttaattaatgaatgcgcatttattactcctatttataacatattagaaataccttattat
tattttgggctaacttattaccacaatcttatgggtaaagaaaaagctaccaaatataaa
actaaattactatccaaaacatctaccattgaaaaagctcctaatattaaagcagagggt
cttaaatgctctgttctatattacgatgattcattcgatgatgctaggatggcaataaca
ttattgagaacttttactgaaaaagggggtattgccctcaactacacggagcttaaaaaa
ttcaacaaggaaaacggaaaactttcaggggttgtcatacaaaataaattgtcaaaagag
caaatttcattaaaaagcaaatgtataataaacgcaacaggaatattttcagatgaaata
agaaaattagacgatgaaaaagctttaaacattatcaaaccttcccaaggtagtcattta
ataatcaaaaaagacaaattccctaaaaatcatgcaatattaatacctaaaactagcgat
aatagaattttatttgctattccttggtatgatagtgttgtttgtggaagcaccgacatt
ccaataaaagagatagaagtagaacccaaaagatttgatgaagaggttgactttataatt
aataatttaaataactatttaaatattaaaatagaaaaatcagatataaaaagcgtatat
actggaataagaccattaataatggatccaaaagctgaaggcaacacttcaaaaatttca
agaaatgaaaaaatatttatatcagattcaaatcttattacaatagcaggggggaaatat
actacatatagaaaaatggcagaaaaaaccttgctcaaggccatagaaaaaaatttaata
ccaaattatccagcaactacagaagatttaaagttacacggctatcttaaaaaagaagag
gcaataaaaattcctgaaccttttagagcttatggtagtgactttgaaattctaaaaaat
atggaagggtttgacaaaaagatacacgaaaacttagatttaaatgaagctcaaatagct
ttttcaattgaatttgagcaagccaaaactattgatgatgttttagcaagaagaacaaga
tcgttacctttaaatccccaagctgcaattgaagctgctccaagagttgctgaaataatg
atgaaaaaattaaataaatctgaagagtggaaaaatgaagaaataaaaaactttttagaa
ttaagtaaaaaatacttaattaataattaa

DBGET integrated database retrieval system