KEGG   Borrelia afzelii (Maryland): BafPKo_0196Help
Entry
BafPKo_0196       CDS       T02093                                 

Definition
(GenBank) D-alanine--D-alanine ligase family protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bafz  Borrelia afzelii (Maryland)
Pathway
bafz00473  D-Alanine metabolism
bafz00550  Peptidoglycan biosynthesis
bafz01100  Metabolic pathways
bafz01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bafz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BafPKo_0196
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BafPKo_0196
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BafPKo_0196
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bafz01011]
    BafPKo_0196
Enzymes [BR:bafz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BafPKo_0196
Peptidoglycan biosynthesis and degradation proteins [BR:bafz01011]
 Precursor biosynthesis
  Amino acid ligase
   BafPKo_0196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_3 GARS_A RimK ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AEL69429
UniProt: Q0SNW3
LinkDB All DBs
Position
complement(199634..200719)
Genome map
AA seq 361 aa AA seqDB search
MKKNLMLIFGGVSFEHEISCKSAYSVYLALLDLNKYNIYSAYIDKCTGIWYLLDSVSDPP
KPIDTDVLPIVSLLPGFGIFSNNKNLEIDVVFPVVHGRTGEDGAIQGVLKVMDIPCVGAG
IIGSAISSNKYFCKLLLKSFNIPIVPFIGFRQYDYSLDKEEIKRNVKEVLGYPVIVKPAV
LGSSIGINVAYSENQIESCIEEALKYDLTIVIEKFIEAREIECSIIGNEKMKIFSPGEVV
VQDFIFYDYDAKYSVIPGNSIIFNIPAHLETNQLLSIKEYAFLVYKNLELRGMARVDFFV
EKKSGTIYLNEINTIPGFTDISMFSKMCSHDGLQFKDLIDNLIDYAFQSYINRKKRINFK
D
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaaaatcttatgttaatatttggcggtgtttcttttgaacatgaaatttcttgc
aaatctgcttatagcgtttatttagcccttttagatttaaataaatacaatatttattct
gcttatattgataagtgtacaggtatttggtatttgttagattctgtttctgatccccca
aagcctattgatacagatgttttacctattgtcagtttattaccaggttttggaattttt
tcaaataacaaaaatcttgagattgatgttgtttttcctgttgttcatggtagaaccggt
gaagatggtgctattcaaggagttttaaaagtcatggacattccatgtgttggtgctggt
attatagggagtgctatttctagtaataagtatttttgtaaacttttgcttaaaagtttt
aatatccccatagtgccttttattgggtttaggcaatatgattattctttagataaagag
gaaataaaaagaaatgtaaaggaggttttaggctatcctgttattgttaagcctgcagta
ttagggtcttcgattggaataaatgtagcttatagtgaaaatcagattgaatcttgtatt
gaggaggctttaaagtatgaccttactattgtaatagagaaatttattgaggctagagag
atcgaatgttctattattggtaatgaaaagatgaaaatattttctcctggggaagttgtt
gtacaggattttatattttatgattatgatgctaaatattctgttattcctggaaattct
attatctttaatatccctgcacatcttgagacaaatcagttgttaagcattaaggaatat
gcttttcttgtttataagaatttagaactcaggggtatggcaagagttgatttttttgtt
gaaaaaaaatcaggaacaatttatcttaatgaaataaatactattccaggatttactgat
atatctatgttttctaaaatgtgtagccatgatggtcttcagtttaaggacttgatagat
aatttaattgattatgcttttcaaagttatattaataggaagaaaaggattaattttaaa
gattaa

DBGET integrated database retrieval system