KEGG   Bacillus coagulans 36D1: Bcoa_0296
Entry
Bcoa_0296         CDS       T01628                                 

Definition
(GenBank) acetoacetyl-CoA synthase
  KO
K01907  acetoacetyl-CoA synthetase [EC:6.2.1.16]
Organism
bag  Bacillus coagulans 36D1
Pathway
bag00280  Valine, leucine and isoleucine degradation
bag00650  Butanoate metabolism
bag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Bcoa_0296
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bcoa_0296
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bag01004]
    Bcoa_0296
Enzymes [BR:bag01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.16  acetoacetate---CoA ligase
     Bcoa_0296
Lipid biosynthesis proteins [BR:bag01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Bcoa_0296
SSDB
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Other DBs
NCBI-ProteinID: AEO99519
UniProt: G2TMM8
LinkDB
Position
complement(297983..299974)
AA seq 663 aa
MKTVTEGALLWQPSRERIEKAGVTRYRKWLEKEYGLTFQHHQDLWKWSVDQLEPFWKSIW
EYCGVISHTPYEQVLKSRTMPGAEWFTGSTLNYAEHVFRNSRKHKPALIFQSETVRQREV
SWQELKEKTAKTAQYLKKLGVQKGDRVVAYMPSMPETVIAFLACASIGAVWSSCSPDFGN
ESVIERFKQIEPAVLFAVDGYSYNGRIFEKRKNITELQASLPTLKKTIVVPYMDFGEIKP
DSSTVSFKEVLKEEAKLAFEPVPFDHPLWILFSSGTTGLPKPIVQGQGGILLEHLKILKV
EQGVEPDDVYFWFTTTGWMMWNLVIGNLLAGVTVVLYDGSPAYPTMDALWDLAEKTGMTH
FGTSAGYISVCMKSGIKPKEKHDLSHLKAILSTGSPLTAEGFIWCYENVKEDLWVVSTSG
GTDLCTAFVGGSPVLPVHAGEIQTRGLGANIQAFDEEGKPVVNEVGELVICDPMPSMPLY
FWGDEGNKRYFESYFDVYPGVWRHGDWIKIDEKGSCVIYGRSDSTINRQGVRMGTSEIYR
AVEGIDEIIESLVIDLEHLGRQSFMPLFVVLKQGRHLDDTLKNRIKTEIRAKVSPRFVPD
EIYEVEQIPKTLSGKKLEVPIRKILLGFPVDKVVNRGSMANPEALDFFIELAQTLNDQKT
ETK
NT seq 1992 nt   +upstreamnt  +downstreamnt
gtgaagacggtcacagaaggggcattattatggcagccgtcaagggagcggattgaaaaa
gcaggggttacccgttaccgtaaatggttggaaaaagaatacggtttaacatttcagcac
caccaggatctttggaaatggtccgtggatcagctggaaccgttttggaaaagcatttgg
gaatactgtggtgtcatatcccatacgccgtatgaacaagtcttgaaatcgaggacaatg
cctggcgccgaatggttcaccgggtctacgctcaactacgccgagcacgttttccgaaac
agcagaaagcataagcctgcgctcattttccaatcggaaaccgtccgccaaagggaagtc
agctggcaggaactgaaggaaaaaacagcaaagacggcgcagtacctgaaaaaacttggc
gtccaaaaaggagaccgggtggtggcatatatgccaagtatgccggaaacggtgatcgct
ttcctagcatgtgcctccattggcgcggtctggtcatcgtgttccccggactttggcaat
gagagcgtcattgagcggtttaaacaaatcgaaccggctgttttatttgcggttgacggc
tattcctataacggcaggatttttgaaaaacgaaaaaacatcacggaactgcaggcgtca
cttccaacgttaaagaaaacgatcgtggtgccttatatggattttggagagataaaaccg
gacagcagcacggtctcctttaaggaagtgctgaaagaagaagctaaactcgcgtttgaa
cctgtaccgtttgatcacccgctgtggattttattttcatccggcacaaccggcctgccg
aaaccgatcgtccagggacagggcggcatccttttggaacacttgaaaattttaaaagtc
gaacaaggggtggagccggatgatgtgtatttttggttcaccacaaccggctggatgatg
tggaatcttgtaatcggcaacttgctggccggggttacggttgtcctgtacgatggcagc
ccggcatacccaactatggatgcattatgggacttggctgaaaaaaccggcatgacccac
ttcggtacaagtgccgggtacattagtgtgtgcatgaaatccggcatcaagccgaaggaa
aaacacgatttatcccatctcaaggcaattttgtcaacgggatccccgcttacggcggaa
ggtttcatttggtgttatgaaaatgtcaaagaggatttatgggtcgtttcgacaagcggg
gggacggacctttgcaccgcatttgtcggcggctcgcctgttttgccggttcatgccggc
gaaattcagacgcgcgggctgggtgcaaatattcaggcatttgacgaggaaggcaaaccg
gttgtgaatgaagtcggggaactggtaatttgcgatccgatgccgtcaatgccgctgtat
ttttggggggatgaaggcaacaaacgttactttgaaagttattttgatgtctatcctggg
gtatggcggcacggggactggatcaaaatcgacgaaaaaggcagctgtgtcatttacggc
cgctccgattccacaattaaccgccaaggcgttcgcatgggcacgagcgaaatttaccgg
gcggtcgaaggcattgatgaaattatcgagagccttgtcatcgaccttgaacatctcggc
aggcaatcgttcatgccgctatttgtcgtcctgaagcagggccggcatttggatgatacg
ttaaaaaaccgcatcaaaaccgaaatccgggcgaaagtttcgccacgctttgtcccggat
gaaatttatgaagttgaacaaatcccaaaaacattgagcggaaagaaactggaagtcccg
atccgtaaaattttgctcggcttcccggtcgataaagtggtgaacaggggttcaatggcc
aatccagaagcacttgacttctttattgaactcgcccaaacgctaaacgatcagaaaact
gaaacaaagtaa

DBGET integrated database retrieval system