KEGG   Bacillus coagulans 36D1: Bcoa_0517Help
Entry
Bcoa_0517         CDS       T01628                                 

Definition
(GenBank) flagellar protein
Organism
bag  Bacillus coagulans 36D1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zinc-ribbons_6 zf-C4pol DUF4238 zf_UBZ DZR DUF1258 Ribosomal_L32p zf-ribbon_3 Coronavirus_5 DUF2039 DUF3797 Ribosomal_L36 zinc_ribbon_2
Motif
Other DBs
NCBI-ProteinID: AEO99740
UniProt: G2TQ92
LinkDB All DBs
Position
complement(531753..532148)
Genome map
AA seq 131 aa AA seqDB search
MAELANCPNCGKLYVKNSVRDVCEDCYREEEAAFERVFQFLRKRENRAATIETIVEKNNV
PEKLVFKWVRSGRLLIAHFPNLAYPCDRCGKLIQSGKLCEECAKTIAKDLERFEKEKKRQ
EEIRKKTYHIK
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggcggagttggcaaactgcccgaattgcggtaaattatatgtcaaaaattccgtccgc
gatgtgtgtgaagactgttatcgcgaggaagaagctgcatttgaacgggtttttcaattc
ttgcggaaacgcgaaaaccgtgcggcaacaatcgagacaattgttgaaaaaaacaatgtc
ccggaaaaactggttttcaaatgggtgcggagcggccggcttttgattgcgcattttccg
aatctggcatatccttgcgaccgttgcggaaaattaatccagtccggaaagttatgcgaa
gaatgtgcaaaaacgattgcaaaagatcttgaacgttttgaaaaagaaaagaaacggcag
gaagaaataaggaaaaagacttatcacatcaagtaa

DBGET integrated database retrieval system