KEGG   Bacillus coagulans 36D1: Bcoa_0619
Entry
Bcoa_0619         CDS       T01628                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
bag  Bacillus coagulans 36D1
Pathway
bag00010  Glycolysis / Gluconeogenesis
bag00071  Fatty acid degradation
bag00350  Tyrosine metabolism
bag00620  Pyruvate metabolism
bag00625  Chloroalkane and chloroalkene degradation
bag00626  Naphthalene degradation
bag00650  Butanoate metabolism
bag01100  Metabolic pathways
bag01110  Biosynthesis of secondary metabolites
bag01120  Microbial metabolism in diverse environments
bag01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bag00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcoa_0619
   00620 Pyruvate metabolism
    Bcoa_0619
   00650 Butanoate metabolism
    Bcoa_0619
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Bcoa_0619
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Bcoa_0619
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bcoa_0619
   00626 Naphthalene degradation
    Bcoa_0619
Enzymes [BR:bag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Bcoa_0619
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Bcoa_0619
SSDB
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Other DBs
NCBI-ProteinID: AEO99838
UniProt: G2TQJ0
LinkDB
Position
complement(650308..652920)
AA seq 870 aa
MAIDEKVVGKSAQITEMVDSLVAKGQKALREFMELDQAQVDNIVKQMALAGLEQHMVLAK
MAVEETGRGVYEDKMTKNLFATEYIYHNIKYNKTVGIIDENNNEGIVKFAEPVGVIAGVT
PVTNPTSTTMFKALIAIKTRNPIIFAFHPSAQKCSSHAAKVMLDAAVKAGAPENCIQWIE
KPAIEATQQLMNHSGISLILATGGSGMVKSAYSSGKPALGVGPGNVPCYIEKSADIKRAV
NDLILSKTFDNGMICASEQAVIIDKEIYDNVKNELIANQCYFLNEAEKKKVEKTVINEKT
QSVNSAIVGKPAYEIAKMAGVNVPEDTKILIAELTGVGPDYPLSREKLSPVLACYKANST
KQGFEFAEAMLEFGGLGHSAVIHSTNDEVIEQYGLKMKAGRIIVNSPSSQGAIGDIYNAY
MPSLTLGCGTFGGNSVSTNVGVINLYNVKTMAKRRVNMQWFKIPPRVYFEKNSVQYLEKM
PDISSAFIVTDPDMVRLGFVEKVLYYLRKRPDYVHCEIFSEVEPDPSIETVRKGAAAMAS
FQPDVIIALGGGSAMDAAKGMWLFYEHPEVDFNELKQKFMDIRKRVAKFPKLGEKAQLVC
IPTTSGTGSEVTSFAVISDKKNNTKYPLADYELTPDVAIIDPQFVMTVPKSVTADTGMDV
LTHAIEAYVSNMANDYTDGLAIKAIQLVHEYLPKAYANGNDALAREKMHNASTLAGMAFS
NAFLGINHSLAHKIGAEFHIPHGRANAILLPHVIRYNAQKPKKFAAFPKYEHFIADQRYA
EIARVLGLPASTTEEGVESLCQEIIRMCKLFNIPLSLKAAGVNRADFEKRVAIIADRAFE
DQCTPANPKLPLVSELEDILRKAFEGVEAK
NT seq 2613 nt   +upstreamnt  +downstreamnt
atggcaatcgatgaaaaagttgttggcaaatctgcgcaaatcacggaaatggtcgattcc
ctcgtcgcaaaagggcaaaaagcactgcgtgaatttatggaactggatcaggcacaagtg
gacaatatcgtaaaacaaatggcacttgccgggttggaacagcatatggtgctcgccaaa
atggccgtggaagaaacagggcgcggcgtatatgaagacaaaatgacaaaaaacttgttt
gcaacagaatacatctatcacaacattaaatataacaaaacagtcggcatcattgacgaa
aacaataatgaagggattgttaaatttgcggaaccggtcggcgtgattgccggggtcact
cctgtaacaaacccgacatcaaccacgatgtttaaagcattaattgccattaaaacacgc
aacccaattattttcgcgttccatccgtccgcacaaaaatgcagcagccatgccgcaaaa
gtgatgcttgacgctgctgtgaaagccggcgccccggaaaactgcatccaatggatcgaa
aaaccggccattgaagcgacacagcaattgatgaaccattcgggtatttcactgattctt
gcaacgggcggttccggcatggtaaagtccgcatattcgagcgggaaacctgcgcttggc
gtcgggccgggaaacgtcccttgctatattgaaaaatctgctgatatcaaacgcgccgtc
aatgatttgattttgtccaaaacgtttgacaacggcatgatctgtgcgtcggaacaggct
gtcatcatcgacaaagaaatttatgacaatgtgaaaaacgaattgattgcaaatcaatgc
tacttcctgaatgaagcggagaagaaaaaggttgagaaaaccgtcatcaatgaaaagacg
caatccgtcaacagcgccattgtcggcaaaccggcctatgaaattgcgaaaatggcaggc
gtaaatgttccggaagataccaaaattttaatcgccgaacttacaggtgtcggcccggac
tacccgctttccagagaaaaattaagcccggttttggcctgttacaaagccaacagcaca
aaacaaggtttcgaatttgcagaagccatgctcgaattcggcggacttggtcactcggct
gtgatccattcgacaaacgatgaagtcattgaacaatacggcttaaaaatgaaagccggc
cggatcattgtcaactccccgtcttcgcaaggggcaatcggcgacatttacaatgcctac
atgccttctttgacactcggctgcggcacgtttggcggcaactcggtgtccacaaacgtc
ggtgtcatcaatctttacaatgtaaaaacaatggcgaaacggagagtcaatatgcaatgg
tttaaaattccaccgcgcgtgtattttgaaaagaactcggtccaatacctggaaaaaatg
ccggatatctcaagtgcctttattgtcaccgatccggatatggtcaggcttggattcgtt
gagaaagtactgtattacttgcggaaacgcccggactatgtgcactgtgaaattttctca
gaagtcgaaccggatccgtctattgaaacggttcggaaaggtgccgcagctatggcaagc
ttccagccggatgtcattatcgcgcttggcggcgggtcggcgatggatgctgcaaaaggc
atgtggctgttctatgagcatccggaagttgatttcaacgaattgaagcaaaaatttatg
gacatccggaaacgggttgccaaattcccgaaactgggtgaaaaagcgcagctggtctgc
attccgaccacatcgggcaccggttctgaagtgacttctttcgccgtcatttcggataaa
aagaacaacacaaaatatccgctcgcagactatgaactgacaccggatgttgcgatcatt
gacccgcagtttgttatgaccgttccgaaatccgtaacagccgataccgggatggacgtt
ttgacccatgcgattgaagcctatgtatccaacatggccaacgactatacggacggcctg
gcaattaaggccatccagcttgttcacgaatacttgccgaaagcatacgcaaatggcaat
gatgcactggcacgcgaaaaaatgcacaatgcatcgactttggcagggatggcgttctcg
aatgcattccttggcatcaaccattcacttgcccataaaatcggcgctgaattccatatt
ccgcacggccgggctaacgcgattctgttgccgcatgtcatccgctataacgcgcaaaag
ccgaaaaaatttgcggcattcccgaaatacgaacattttattgcggatcaacgctacgcg
gaaatcgcgcgcgtacttggtcttccggcaagcacgacagaagaaggtgtcgaaagcctt
tgccaggaaatcatccggatgtgcaaactgttcaatattccgcttagcctaaaagcagcc
ggcgtgaaccgggcggactttgaaaaacgggttgccattattgcagaccgcgcatttgaa
gaccaatgcacacctgcaaaccctaaattgccgcttgtcagcgaattggaagacatttta
cgcaaagcttttgaaggcgttgaagcaaaataa

DBGET integrated database retrieval system